DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src42A and CSK

DIOPT Version :9

Sequence 1:NP_610191.2 Gene:Src42A / 35524 FlyBaseID:FBgn0264959 Length:1597 Species:Drosophila melanogaster
Sequence 2:NP_001120662.1 Gene:CSK / 1445 HGNCID:2444 Length:450 Species:Homo sapiens


Alignment Length:399 Identity:167/399 - (41%)
Similarity:228/399 - (57%) Gaps:38/399 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1202 GEFLNEKSWYFRKIKRIEAEKKLLLPENEHGAFLIRDSESRHNDYSLSVRDGDTVKHYRIR---- 1262
            |..|:...|:..||.|.:||:.|..||.  |.||:|:|.:...||:|.|.....|:||||.    
Human    74 GTKLSLMPWFHGKITREQAERLLYPPET--GLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHAS 136

  Fly  1263 --QLDEGGFFIARRTTFRTLQELVEHYSKDSDGLCVNLCKPCVQIEKPVTEGL----SHRTRDQW 1321
              .:||       ...|..|.:|||||:.|:||||..|.||      .|.||.    ....|..|
Human   137 KLSIDE-------EVYFENLMQLVEHYTSDADGLCTRLIKP------KVMEGTVAAQDEFYRSGW 188

  Fly  1322 EIDRTSLKFVRKLGSGQFGDVWEGLWNNTTPVAIKTLKSGTMDPKDFLAEAQIMKKLRHTKLIQL 1386
            .::...||.::.:|.|:||||..|.:.. ..||:|.:|:.. ..:.|||||.:|.:|||:.|:||
Human   189 ALNMKELKLLQTIGKGEFGDVMLGDYRG-NKVAVKCIKNDA-TAQAFLAEASVMTQLRHSNLVQL 251

  Fly  1387 YAVCTVEEP--IYIITELMKHGSLLEYLQAIAGKGRS-LKMQTLIDMAAQIAAGMAYLESQNYIH 1448
            ..| .|||.  :||:||.|..|||::||::   :||| |....|:..:..:...|.|||..|::|
Human   252 LGV-IVEEKGGLYIVTEYMAKGSLVDYLRS---RGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVH 312

  Fly  1449 RDLAARNVLVGDGNIVKIADFGLARLIKEDEYEARVGARFPIKWTAPEAANYSKFSIKSDVWSFG 1513
            ||||||||||.:.|:.|::||||.   ||.......| :.|:|||||||....|||.||||||||
Human   313 RDLAARNVLVSEDNVAKVSDFGLT---KEASSTQDTG-KLPVKWTAPEALREKKFSTKSDVWSFG 373

  Fly  1514 ILLTELVTYGRIPYPGMTNAEVLTQVEHGYRMPQPPNCEPRLYEIMLECWHKDPMRRPTFETLQW 1578
            |||.|:.::||:|||.:...:|:.:||.||:|..|..|.|.:||:|..|||.|...||:|..|:.
Human   374 ILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLRE 438

  Fly  1579 KLEDFYTSD 1587
            :||...|.:
Human   439 QLEHIKTHE 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src42ANP_610191.2 SH2_Src_Src42 1210..1301 CDD:198233 38/96 (40%)
PTKc_Frk_like 1319..1587 CDD:270653 121/270 (45%)
Pkinase_Tyr 1328..1580 CDD:285015 117/254 (46%)
CSKNP_001120662.1 Interaction with PTPN22. /evidence=ECO:0000250|UniProtKB:P41241 9..70
SH3_CSK 11..67 CDD:212703
SH2_csk_like 78..175 CDD:198190 41/111 (37%)
PTKc_Csk 188..443 CDD:133213 120/264 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.