DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src42A and sla2a

DIOPT Version :9

Sequence 1:NP_610191.2 Gene:Src42A / 35524 FlyBaseID:FBgn0264959 Length:1597 Species:Drosophila melanogaster
Sequence 2:XP_009304328.1 Gene:sla2a / 100536664 ZFINID:ZDB-GENE-141216-296 Length:254 Species:Danio rerio


Alignment Length:252 Identity:82/252 - (32%)
Similarity:113/252 - (44%) Gaps:46/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1146 IEKSRSLPAACSASCSHTCAHLSVID--QSPATTKCFG-KTSLTTAKKGKSRRLSEFTRGE-FLN 1206
            :|::..||.  .||.|||...|....  :|...|.|.| |.::.:......|..|..|..| |:.
Zfish    17 LEETVLLPD--GASGSHTAVALCNFPSFRSDEHTICLGDKLNIISEDDDMLRVCSTSTGNECFIP 79

  Fly  1207 -------EKSWYFRKIKRIEAEKKLLLPENEHGAFLIRDSESRHNDYSLSVRDGD----TVKHYR 1260
                   ...|:|..|.|..||:.|:||:|..|.||||:|:|....||||||...    ||.||:
Zfish    80 HTYVSKVHDQWFFEGISRRNAEQLLMLPQNYSGCFLIRESQSFPGLYSLSVRQHSGQMHTVLHYK 144

  Fly  1261 IRQLDEGGFFIARRTTFRTLQELVEHYSKDSDGLCVNLCKPC---------VQIEKPVTEGLSHR 1316
            |.||..|.|:|.....|.||.:||::||:.|.|...:|.:||         .....||.   :.:
Zfish   145 IYQLHNGWFYIQPNHPFSTLSQLVDYYSRSSVGSFCHLTEPCRLHDSIPTAAHSPSPVA---AQK 206

  Fly  1317 TRDQW-EIDRTSLKFVRKL-GSGQFGDVWEGLWNNTTPVAIKTLKSGTMDPKDFLAE 1371
            :...| |:..:.:|  |:| |..|...|.|||             ..||:...:|||
Zfish   207 SNFNWRELSTSMIK--RQLKGMDQESLVSEGL-------------RETMNAYFYLAE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src42ANP_610191.2 SH2_Src_Src42 1210..1301 CDD:198233 43/94 (46%)
PTKc_Frk_like 1319..1587 CDD:270653 16/55 (29%)
Pkinase_Tyr 1328..1580 CDD:285015 14/45 (31%)
sla2aXP_009304328.1 SH3 32..86 CDD:302595 12/53 (23%)
SH2 79..180 CDD:301589 42/100 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.