DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mle and AT5G14900

DIOPT Version :10

Sequence 1:NP_476641.1 Gene:mle / 35523 FlyBaseID:FBgn0002774 Length:1293 Species:Drosophila melanogaster
Sequence 2:NP_196994.1 Gene:AT5G14900 / 831342 AraportID:AT5G14900 Length:301 Species:Arabidopsis thaliana


Alignment Length:249 Identity:53/249 - (21%)
Similarity:103/249 - (41%) Gaps:34/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   800 TPLHEMALTIKLLRLGSIHHFLSKALEPPPVDAVIEAEVLLREMRCLDANDELTPLGRLLARLPI 864
            |.|....||:|.|.:.::..|  ..::.|..|.:..|...|..:..||.:..||..|.:::..|:
plant     2 TNLANTVLTLKGLSVKNLVRF--DLIDSPAPDTLARALDDLYHLGALDDDCNLTKTGEMMSEFPL 64

  Fly   865 EPRLGKMMVLGAVFGCA-DLMAI--MASYSSTFSEVFSLDIGQRRLANHQKALSGTKCS------ 920
            :|::.||:::...|.|: ::::|  |.|..:.|.         |.....|||....|.|      
plant    65 DPQMAKMLIVSPQFNCSNEILSISAMLSVPNCFI---------RPRGEAQKAADEAKSSFAHIDG 120

  Fly   921 DHVAMIVASQMWRREKQRGEHMEARFCDWKGLQMSTMNVIWDAKQQLLDLLQQAGFPEECMISHE 985
            ||:.::.....:.:..|     :..:|..|.:....|......::||:.::.:....   :.|.:
plant   121 DHLTLLNLFHAFLQNNQ-----DPNWCCTKFINYRAMKSAVSVREQLVRIMLRFQIK---LCSPD 177

  Fly   986 VDERIDGDDPVLDVSLALLCLGLYPNICVHKEKRKVLTTESK-AALLHKTSVNC 1038
            .:.|    |..:::..|||. |.:..:...:.....||...| ..::|....||
plant   178 FNSR----DYYVNIRKALLA-GYFMQVAHLERTGHYLTFRDKDDQVVHLHPSNC 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mleNP_476641.1 DSRM_DHX9_rpt1 2..70 CDD:380683
DSRM_DHX9_rpt2 167..241 CDD:380684
DEXHc_DHX9 326..559 CDD:350730
HrpA 378..>889 CDD:441249 24/91 (26%)
OB_NTP_bind 1002..1079 CDD:400182 10/38 (26%)
AT5G14900NP_196994.1 PRK11131 <2..>267 CDD:182986 53/249 (21%)
HA2 36..125 CDD:461295 25/97 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.