DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mle and T07D4.5

DIOPT Version :9

Sequence 1:NP_476641.1 Gene:mle / 35523 FlyBaseID:FBgn0002774 Length:1293 Species:Drosophila melanogaster
Sequence 2:NP_001122634.1 Gene:T07D4.5 / 6418633 WormBaseID:WBGene00045407 Length:142 Species:Caenorhabditis elegans


Alignment Length:125 Identity:28/125 - (22%)
Similarity:44/125 - (35%) Gaps:40/125 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   691 HSQIPRDEQRKVFEPVPEGVTKIILSTNI---AETSITIDDIVFVIDICKARMKLFTSHNNLTSY 752
            :::.|.|.|:::.:...|   .|.|||.:   .||.:.:|                   |....:
 Worm    13 NAKTPHDHQKELRDKTSE---IIYLSTKLNHAKETCVNLD-------------------NERQKF 55

  Fly   753 ATVWASKTNLEQRKGRAGRVRP-----GFCFTLCSRAR-FQALE-DNLTPEMFRTPLHEM 805
            ..|        .||.:...:.|     |.||...|:|. ...|| |..|.|..|..:.|:
 Worm    56 REV--------SRKIKEKDIDPVWIYNGTCFLQTSQANSLNILEKDTKTVEEVRGQIQEV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mleNP_476641.1 DSRM 4..68 CDD:214634
DSRM 170..240 CDD:214634
DEXDc 393..569 CDD:214692
DEXDc 402..542 CDD:238005
ATP-synt_B <584..644 CDD:304375
Helicase_C 643..772 CDD:278689 15/83 (18%)
HA2 842..926 CDD:214852
OB_NTP_bind 974..1078 CDD:285018
T07D4.5NP_001122634.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.