powered by:
Protein Alignment mle and Zcchc17
DIOPT Version :9
Sequence 1: | NP_476641.1 |
Gene: | mle / 35523 |
FlyBaseID: | FBgn0002774 |
Length: | 1293 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_694800.1 |
Gene: | Zcchc17 / 619605 |
MGIID: | 1919955 |
Length: | 241 |
Species: | Mus musculus |
Alignment Length: | 68 |
Identity: | 17/68 - (25%) |
Similarity: | 34/68 - (50%) |
Gaps: | 7/68 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 1027 KAALLHKTSVNCSNLAVTFPYPFFVFGEKIRTRAVSCK----QLSMVSPLQVILFGSRKIDLAAN 1087
|..|:|:| :.|:..|..|......|:|:..:.:..: ::.:...::|:..|:.| ||..|
Mouse 40 KQGLVHRT--HMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGK-DLDPN 101
Fly 1088 NIV 1090
|:|
Mouse 102 NVV 104
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1643 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.