DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mle and Zcchc17

DIOPT Version :10

Sequence 1:NP_476641.1 Gene:mle / 35523 FlyBaseID:FBgn0002774 Length:1293 Species:Drosophila melanogaster
Sequence 2:NP_694800.1 Gene:Zcchc17 / 619605 MGIID:1919955 Length:241 Species:Mus musculus


Alignment Length:68 Identity:17/68 - (25%)
Similarity:34/68 - (50%) Gaps:7/68 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1027 KAALLHKTSVNCSNLAVTFPYPFFVFGEKIRTRAVSCK----QLSMVSPLQVILFGSRKIDLAAN 1087
            |..|:|:|  :.|:..|..|......|:|:..:.:..:    ::.:...::|:..|:.| ||..|
Mouse    40 KQGLVHRT--HMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGK-DLDPN 101

  Fly  1088 NIV 1090
            |:|
Mouse   102 NVV 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mleNP_476641.1 DSRM_DHX9_rpt1 2..70 CDD:380683
DSRM_DHX9_rpt2 167..241 CDD:380684
DEXHc_DHX9 326..559 CDD:350730
HrpA 378..>889 CDD:441249
OB_NTP_bind 1002..1079 CDD:400182 10/55 (18%)
Zcchc17NP_694800.1 S1_pNO40 13..86 CDD:240191 9/47 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..241
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.