powered by:
Protein Alignment mle and zcchc17
DIOPT Version :9
Sequence 1: | NP_476641.1 |
Gene: | mle / 35523 |
FlyBaseID: | FBgn0002774 |
Length: | 1293 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_956838.2 |
Gene: | zcchc17 / 393516 |
ZFINID: | ZDB-GENE-040325-2 |
Length: | 235 |
Species: | Danio rerio |
Alignment Length: | 71 |
Identity: | 19/71 - (26%) |
Similarity: | 35/71 - (49%) |
Gaps: | 18/71 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 1122 AC--DNPSDILRL-EEPYAQLV-KVVKD------LCVKSAGDFGLQRE---SGILPHQS----RQ 1169
|| :||::|:.: |:.:.::: |.:|| ..:||... |..|: :.::..|. ||
Zfish 54 ACRVENPAEIVDVGEQVWIKVIGKEMKDDKVKLSFSMKSVNQ-GTGRDLDPNNVIAEQDERRRRQ 117
Fly 1170 FSDGGG 1175
|.|..|
Zfish 118 FRDHSG 123
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1643 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.