DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7881 and SLC17A9

DIOPT Version :9

Sequence 1:NP_001286144.1 Gene:CG7881 / 35521 FlyBaseID:FBgn0033048 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_071365.4 Gene:SLC17A9 / 63910 HGNCID:16192 Length:436 Species:Homo sapiens


Alignment Length:458 Identity:107/458 - (23%)
Similarity:187/458 - (40%) Gaps:104/458 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LFLAIVVNYTARLSVSVAIVAMTDAATTNLDFPEYNWNGVQQSYILSSFYWGYIVTQFPAGFLVR 84
            |.|...:.|.||.|:.:..|:|:.         ::.||..:...:||||:|||.:||...|.|..
Human    30 LLLGTCLLYCARSSMPICTVSMSQ---------DFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGD 85

  Fly    85 RFGAKAVLLVPTLATAVLSGLTPYCVAWGGWQ-AFCTI-RIVEGLFQGLIFPCIHEHLAKWSPPE 147
            |.|.:.|:|:...|...::.:||......... ||.|. ||:.||.||:.||.:...|::.....
Human    86 RIGGEKVILLSASAWGSITAVTPLLAHLSSAHLAFMTFSRILMGLLQGVYFPALTSLLSQKVRES 150

  Fly   148 DRNRLGAFAYSGADCGSVLAMASSGLIANGSM-----GWPGIFYVSAGTCGLWCLLWVLFGANNA 207
            :|    ||.||....||......:|.:  ||:     ||..|||.|.|...||  :|.::     
Human   151 ER----AFTYSIVGAGSQFGTLLTGAV--GSLLLEWYGWQSIFYFSGGLTLLW--VWYVY----- 202

  Fly   208 PSSRLIGSREREHIERSMKRQDGFHAQKIP------IPWR------AIW--------SSSPFYAL 252
               |.:.|      |:.:....|..||..|      :|||      |:|        ::..|:.|
Human   203 ---RYLLS------EKDLILALGVLAQSRPVSRHNRVPWRRLFRKPAVWAAVVSQLSAACSFFIL 258

  Fly   253 L---------VVRSAQGWANSTMQLQTPSYMHGVLEMDIKSNALYSALPFLAMWGMSYVYLVFAD 308
            |         ....|:||                         :::.:|:|.....|......:|
Human   259 LSWLPTFFEETFPDAKGW-------------------------IFNVVPWLVAIPASLFSGFLSD 298

  Fly   309 VAMSRQWMSLTTLRKSINTVSYWGPAAALIGIGFLDKSQTTL---AIALMTINAGLNAGSGIGSI 370
            ..:::.:.:: |:||.:.     |....|..:..|....|:.   ::...:.:.||...:..|..
Human   299 HLINQGYRAI-TVRKLMQ-----GMGLGLSSVFALCLGHTSSFCESVVFASASIGLQTFNHSGIS 357

  Fly   371 LTIIDMSPNHSGMLMAIVNGIGNIFPLLTPLLVGVIVTESDSRSQWQIVFAMTAVVFFIGNLVYL 435
            :.|.|::|:.:|.|..:.|..|.:..::...|.|.::   ::...|..:|.:.|::..:|...:|
Human   358 VNIQDLAPSCAGFLFGVANTAGALAGVVGVCLGGYLM---ETTGSWTCLFNLVAIISNLGLCTFL 419

  Fly   436 IWG 438
            ::|
Human   420 VFG 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7881NP_001286144.1 2A0114euk 12..449 CDD:129972 107/458 (23%)
MFS 18..437 CDD:119392 106/455 (23%)
SLC17A9NP_071365.4 MFS_1 44..386 CDD:311564 93/403 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.