DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7881 and mfs2

DIOPT Version :9

Sequence 1:NP_001286144.1 Gene:CG7881 / 35521 FlyBaseID:FBgn0033048 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_592802.1 Gene:mfs2 / 2542991 PomBaseID:SPAC11D3.05 Length:546 Species:Schizosaccharomyces pombe


Alignment Length:203 Identity:36/203 - (17%)
Similarity:62/203 - (30%) Gaps:71/203 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 WGMSY------------VYLVFADVAMSRQWMSLTTLRKSINTVSYWGPAAALIGIG-------- 341
            |..||            :.:.||....|...:.:.:...|...||..|....|:|.|        
pombe   100 WSHSYKWWIVIQVSVITIVVTFASSVYSSGIIDIASELHSSIPVSTLGSCTFLVGFGVGSLPFAP 164

  Fly   342 -------FLDKSQTTLAIALMTINAG-----------------------LNAGSGIGSILTIIDM 376
                   |:....|.|...:..:..|                       .|||..|..:.|.:..
pombe   165 LSDIYGRFIIYFVTLLIFTIFQVGGGCAHNVWTLAIVRFFQGVFGSTPLANAGGTISDLFTPVQR 229

  Fly   377 SPNHSGMLMAIVNGIGNIFPLLTPL---LVGVIVTESDSRSQW----QIVFAMTAVVFFIGNLVY 434
            :....|..         .||.|.|:   ::|..:|:|....:|    .:::|...:||     |:
pombe   230 TYVLPGFC---------TFPYLGPIIGPIIGDFITQSYLEWRWTFWINMIWAAAVIVF-----VF 280

  Fly   435 LIWGTTDQ 442
            :.:..|.:
pombe   281 IFFPETHE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7881NP_001286144.1 2A0114euk 12..449 CDD:129972 36/203 (18%)
MFS 18..437 CDD:119392 35/196 (18%)
mfs2NP_592802.1 MFS 109..530 CDD:119392 33/194 (17%)
MFS_1 112..493 CDD:284993 33/191 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.