DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7881 and SLC37A4

DIOPT Version :9

Sequence 1:NP_001286144.1 Gene:CG7881 / 35521 FlyBaseID:FBgn0033048 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001157750.1 Gene:SLC37A4 / 2542 HGNCID:4061 Length:451 Species:Homo sapiens


Alignment Length:409 Identity:90/409 - (22%)
Similarity:152/409 - (37%) Gaps:66/409 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 YILSSFYWGYIVTQFPAGFLVRRFGAK-----AVLLVPTLATAVLSGLTPYCVAWGGW-QAFCTI 121
            :|.||....|.:::|.:|.|..:..|:     .:|||         ||.....||... ..|..:
Human    51 FITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLV---------GLVNIFFAWSSTVPVFAAL 106

  Fly   122 RIVEGLFQGLIFPCIHEHLAKWSPPEDRNRLGAFAYSGADCGSVLAMASSGLIANGSMGWPGIFY 186
            ..:.||.|||.:|...:.|.||..|.......|...:..:....|....:.::|. |..|.....
Human   107 WFLNGLAQGLGWPPCGKVLRKWFEPSQFGTWWAILSTSMNLAGGLGPILATILAQ-SYSWRSTLA 170

  Fly   187 VSAGTC---GLWCLLWVLFGANNAPSSRLIGSREREHI----ERSMKRQDGFHAQKIPIPWRAIW 244
            :|...|   ...|||.:    :|.|:.  :|.|..:.:    ::...:::....:.:..|:  :|
Human   171 LSGALCVVVSFLCLLLI----HNEPAD--VGLRNLDPMPSEGKKGSLKEESTLQELLLSPY--LW 227

  Fly   245 SSSPFYALL--VVRSAQGWA-------NSTMQLQTPSYMHGVLEMD--IKSNAL-YSALPFLAMW 297
            ..|..|.::  |......|.       .....|...||| ..||:.  :.|.|. |.:...:|..
Human   228 VLSTGYLVVFGVKTCCTDWGQFFLIQEKGQSALVGSSYM-SALEVGGLVGSIAAGYLSDRAMAKA 291

  Fly   298 GMS--------YVYLVFADVAMSRQWMSLTTLRKSINTVSYW----GPAAALIGIGFLDKSQTTL 350
            |:|        .:..:.|.:.:|.....:|....|...|::|    .|.|.|.|.     ::..|
Human   292 GLSNYGNPRHGLLLFMMAGMTVSMYLFRVTVTSDSPKDVAFWTLALHPLAELTGF-----TEHEL 351

  Fly   351 AIALMTINAGLNAGSGIGSILTIIDMS--PNHSGMLMAIVNGIGNIFPLLTPLLVGVIVTE-SDS 412
            .|.::....|.::...|.....|.:.|  ||..|...|||..:.|:...|..|....|... |.|
Human   352 WILVLGAVFGFSSYGPIALFGVIANESAPPNLCGTSHAIVGLMANVGGFLAGLPFSTIAKHYSWS 416

  Fly   413 RSQW--QIVFAMTAVVFFI 429
            .:.|  :::.|.:...||:
Human   417 TAFWVAEVICAASTAAFFL 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7881NP_001286144.1 2A0114euk 12..449 CDD:129972 90/409 (22%)
MFS 18..437 CDD:119392 90/409 (22%)
SLC37A4NP_001157750.1 MFS 14..437 CDD:119392 90/409 (22%)
2A0104 18..419 CDD:273319 86/391 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148679
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.