DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7881 and SLC17A8

DIOPT Version :9

Sequence 1:NP_001286144.1 Gene:CG7881 / 35521 FlyBaseID:FBgn0033048 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_647480.1 Gene:SLC17A8 / 246213 HGNCID:20151 Length:589 Species:Homo sapiens


Alignment Length:464 Identity:138/464 - (29%)
Similarity:242/464 - (52%) Gaps:38/464 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RHMQALLLFLAIVVNYTARLSVSVAIVAMTDAATTNLD-FPE-----YNWNGVQQSYILSSFYWG 71
            |::.|::..|...:::..|.::.||||.|.:.:|..:| .||     :||:......|..||:||
Human    75 RYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPEIQTAQFNWDPETVGLIHGSFFWG 139

  Fly    72 YIVTQFPAGFLVRRFGAKAVLLVPTLATAVLSGLTPYC--VAWGGWQAFCT--IRIVEGLFQGLI 132
            ||:||.|.||:..:|.|..|.......|:.|:...|..  |.:|     |.  :||::||.:|:.
Human   140 YIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARVHYG-----CVMCVRILQGLVEGVT 199

  Fly   133 FPCIHEHLAKWSPPEDRNRLGAFAYSGADCGSVLAMASSGLIANGSMGWPGIFYVSAGTCG-LWC 196
            :|..|...:||:||.:|:||...::.|:..|:|:||..:|::.. .:||..:||: .|..| :|.
Human   200 YPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQ-YIGWSSVFYI-YGMFGIIWY 262

  Fly   197 LLWVLFGANNAPSSR-LIGSREREHIERSMKRQDGFHA---QKIPIPWRAIWSSSPFYALLVVRS 257
            :.|:| .|...|::. .|.:.|:.:||.|:  .:|.:.   .|...||:..::|.|.||::|...
Human   263 MFWLL-QAYECPAAHPTISNEEKTYIETSI--GEGANVVSLSKFSTPWKRFFTSLPVYAIIVANF 324

  Fly   258 AQGWANSTMQLQTPSYMHGVLEMDIKSNALYSALPFLAMWGMSYVYLVFADVAMSRQWMSLTTLR 322
            .:.|....:.:..|:|...|....|....|.||:|.:.|..:..:....||...|||.::.|.:|
Human   325 CRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRQILTTTAVR 389

  Fly   323 KSINTVSYWGPAAALIGIGFLDKSQTT-LAIALMTINAGLNAGSGIGSILTIIDMSPNHSGMLMA 386
            |.:|...:...|..|:.:||   |.|. :||:.:.:..|.:..:..|..:..:|::|.::.:||.
Human   390 KIMNCGGFGMEATLLLVVGF---SHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMG 451

  Fly   387 IVNGIGNIFPLLTPLLVGVIVTESDSRSQWQIVFAMTAVVFFIGNLVYLIWGTTDQQAWDAEDYL 451
            |.||:|.:..::.||:||. :|...:|.:||.||.:.|:|.:.|.:.|.::.:.::|.|      
Human   452 ISNGVGTLSGMVCPLIVGA-MTRHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQEW------ 509

  Fly   452 QAKDPESES 460
              .|||:.|
Human   510 --ADPENLS 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7881NP_001286144.1 2A0114euk 12..449 CDD:129972 134/451 (30%)
MFS 18..437 CDD:119392 130/434 (30%)
SLC17A8NP_647480.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..61
2A0114euk 75..513 CDD:129972 135/459 (29%)
MFS 80..502 CDD:119392 130/435 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148607
Domainoid 1 1.000 49 1.000 Domainoid score I11776
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.