DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7881 and Y19D10A.5

DIOPT Version :9

Sequence 1:NP_001286144.1 Gene:CG7881 / 35521 FlyBaseID:FBgn0033048 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_503656.2 Gene:Y19D10A.5 / 189483 WormBaseID:WBGene00021220 Length:478 Species:Caenorhabditis elegans


Alignment Length:475 Identity:101/475 - (21%)
Similarity:198/475 - (41%) Gaps:59/475 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RHMQALLLFLAIVVNYTARLSVSVAIVAMTDAATT-NLDFP-EYNW--NGVQQSYILSSFYWGYI 73
            |::..:|....:.:.....|:.:..::.|:|.:.. ::..| |.:|  :...:|.:.||...|.:
 Worm    34 RYLILILTLTCLTLLQMNSLAFNFTVICMSDVSDDYHITHPNETHWFEDSNMKSLVFSSMAVGGL 98

  Fly    74 VTQFPAGFLVRRFGAKAVLLVPTLATAVLSGLTPYCVAWGGWQAFCTIRIVEGLFQGLIFPCIHE 138
            :....|..|:.|.|.:.||.:..:.:.:.:.|.|..|.|..:... .:|.::||...::|..:..
 Worm    99 LGLLIAMPLMHRVGVRLVLSICGVFSILGTILFPLAVEWNFFSVL-VVRFLQGLGISMVFTVLGS 162

  Fly   139 HLAKWSPPEDRNRLGAFAYSGADCGSVLAMASSGLIANGSMGWPGIFYVSAGTCGLWCLLWVLFG 203
            ....|:|..:.....|.........:|:.|..||.:...|.||..|:|:......::.|.:..|.
 Worm   163 VPTAWAPNNESGTFLAVLSCAFQWSNVICMPISGFLCESSWGWRSIYYLFGIVTIVFFLAFYFFY 227

  Fly   204 ANNAPSSRLIGSREREHIERSMKRQDGFHAQKIPIPWRAIWSSSPFYALLVVRSAQGWANS---- 264
            .::....|.:.::     |.|:..||.....|.|:|:.||....   .:||.     |.::    
 Worm   228 TDSPTDHRNVSNK-----ELSLILQDKTVTHKEPVPYLAICKDP---CVLVT-----WMSNIGGN 279

  Fly   265 ----TMQLQTPSYMHGVLEMDIKSNALYSALPFLAMWGMSYVYLVFADVAMSRQWMSLTTLRKSI 325
                |:.|..|:|:..||..:::.....||||||    :|......|.....|.......:|.:|
 Worm   280 LGFLTLVLYGPTYLREVLNFEVRGTGFASALPFL----LSAAVKSIAGQLSDRCDFVSERVRFTI 340

  Fly   326 NTVSYWGPAAAL-IGIGFLDKSQT----------TLAIALMTINAGLNAGSGIGSILTIIDMSPN 379
                 .|..|.| :.||::..:.|          |.:||:    :|||.   :|::..:......
 Worm   341 -----CGIVARLGLAIGYIGMATTSSRLVAQIAFTFSIAV----SGLNI---MGTVKCLQLRCKQ 393

  Fly   380 HSGMLMAIVNGIGNIFPLLTPLLVGVIVTESDSRSQWQIVFAMTAVVFFIGNLVYLIWGTTDQQA 444
            |....::::..:..:.....|:|||:|..: ::..||...|.:..::.|:.:..: .|.||.:.|
 Worm   394 HVHFAVSVIALMAYVIQFGAPILVGIICPD-NTAEQWGWFFLIVGIIVFVTSAPF-PWFTTAEPA 456

  Fly   445 WDAEDYLQAKDPESESNAHQ 464
                ||..:::.:.|...|:
 Worm   457 ----DYTLSREKQLEIAKHK 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7881NP_001286144.1 2A0114euk 12..449 CDD:129972 97/458 (21%)
MFS 18..437 CDD:119392 92/441 (21%)
Y19D10A.5NP_503656.2 MFS 56..443 CDD:391944 90/417 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28615
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.