DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7881 and F41C3.2

DIOPT Version :9

Sequence 1:NP_001286144.1 Gene:CG7881 / 35521 FlyBaseID:FBgn0033048 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_494849.2 Gene:F41C3.2 / 173821 WormBaseID:WBGene00018268 Length:499 Species:Caenorhabditis elegans


Alignment Length:444 Identity:92/444 - (20%)
Similarity:179/444 - (40%) Gaps:61/444 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YNWNGVQQSYILSSFYWGYIVTQFPAGFLVRRFGAKAVLLVPTLATAVLSGLTPYCVAWGGWQAF 118
            :|::..:|..:.|:.|...:.:.....||..|.|.|...|:.::.:.:.:.|||....:|.| .|
 Worm    87 FNFSKFEQDLLFSAAYIAPLPSIIILYFLTNRSGVKTTFLICSMLSFLSTILTPIATQYGFW-FF 150

  Fly   119 CTIRIVEGL---FQGLIFPCIHEHLAKWSPPEDRNRLGAFAYSGADCGSVLAMASSGLIANGSMG 180
            ...|..:||   ..|::...:..|   ||...:.....:...:......:|.|..|.|:.:.. |
 Worm   151 WAARFFQGLPTAILGIVVSVVTCH---WSTLTENGTYVSILAAHYQIAPLLTMPLSALMCSVG-G 211

  Fly   181 WPGIFYVSAGTCGLWCLLWVLFGANNAPSSRLIG-----------SREREHIERSMKRQDGFHAQ 234
            |..::|.......:..:|:.:|..:....|:.:.           |.|.:|:|:|.......|  
 Worm   212 WSSVYYTQGTITAILIVLFAVFYTDKPSESKFVSKGELKAIEDGKSLEEKHVEKSKTPFVAIH-- 274

  Fly   235 KIPIPWRAIWSSSPFYALLVVRSAQGWANSTMQLQ-TPSYMHGVLEMDIKSNALYSALPFLAMWG 298
            |.|..| |||          :.|..|....::.|| .|:|::.||..::.:....:|:|      
 Worm   275 KDPAVW-AIW----------ITSVGGTIGFSIFLQYGPTYLNKVLHYNLSTTGWTAAVP------ 322

  Fly   299 MSYVYLVFADVAMSRQWMSLTTLRKSI-----NTVSYWGPAAALIGIGFLDKSQTT---LAIALM 355
              |::...|.:.......:.:.|.:.:     .|:|....|...:.:.|:.::.::   |..:|:
 Worm   323 --YIFSCIARIVAQPLSANCSFLGERLAAIVTTTISQGTMAICFLVLMFIPQTWSSVGQLCYSLV 385

  Fly   356 TINAGLNAGSGIGSILTIIDMSPNHSGML---MAIVNGIGNIFPLLTPLLVGVIVTESDSRSQWQ 417
            .:..|||   |:|...:...:...|...:   .|..||...:|   .||||. .|..:|:.::|.
 Worm   386 IVANGLN---GVGITRSAQLVCKQHMSFVYTARAFYNGSVGLF---LPLLVN-FVAPNDTHNEWT 443

  Fly   418 IVFAMTAVVFFIGNLVYLIWGTTDQQAWDAEDYLQAKDPESESNAHQMEFKSRT 471
            .:|.:...:.|:.||:::.:.:|:...|...  ....|..||.:....:..|.|
 Worm   444 RLFLIIFCIVFVSNLIFIAFSSTEPAQWTIG--TSEVDNRSEQDLEDQKSTSTT 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7881NP_001286144.1 2A0114euk 12..449 CDD:129972 87/420 (21%)
MFS 18..437 CDD:119392 85/408 (21%)
F41C3.2NP_494849.2 2A0114euk 30..471 CDD:129972 86/416 (21%)
MFS 86..463 CDD:119392 85/408 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.