powered by:
Protein Alignment CG7881 and C06E7.88
DIOPT Version :9
Sequence 1: | NP_001286144.1 |
Gene: | CG7881 / 35521 |
FlyBaseID: | FBgn0033048 |
Length: | 482 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001255275.2 |
Gene: | C06E7.88 / 13194964 |
WormBaseID: | WBGene00189995 |
Length: | 167 |
Species: | Caenorhabditis elegans |
Alignment Length: | 44 |
Identity: | 10/44 - (22%) |
Similarity: | 12/44 - (27%) |
Gaps: | 20/44 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 134 PCIHE--------------------HLAKWSPPEDRNRLGAFAY 157
||..| :|.|..|...|:..|.|.|
Worm 68 PCFEEEIDGKQRNYCNIVCPGADTAYLIKRIPQNHRSCFGHFTY 111
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG7881 | NP_001286144.1 |
2A0114euk |
12..449 |
CDD:129972 |
10/44 (23%) |
MFS |
18..437 |
CDD:119392 |
10/44 (23%) |
C06E7.88 | NP_001255275.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2532 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.