DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7881 and SLC17A2

DIOPT Version :9

Sequence 1:NP_001286144.1 Gene:CG7881 / 35521 FlyBaseID:FBgn0033048 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001273052.1 Gene:SLC17A2 / 10246 HGNCID:10930 Length:478 Species:Homo sapiens


Alignment Length:470 Identity:131/470 - (27%)
Similarity:235/470 - (50%) Gaps:33/470 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KGP-VIGIRHMQALLLFLAIVVNYTARLSVSVAIVAM---------TDAAT----------TNLD 50
            ||| ...:|:..||::..:.....|.|:|:|:||:||         ::|:|          :::.
Human     9 KGPDFCSLRYGLALIMHFSNFTMITQRVSLSIAIIAMVNTTQQQGLSNASTEGPVADAFNNSSIS 73

  Fly    51 FPE-------YNWNGVQQSYILSSFYWGYIVTQFPAGFLVRRFGAKAVLLVPTLATAVLSGLTPY 108
            ..|       |.|:...|..|.||..:|.|:|..|:|:|...||||.:|....|.:::|:..||.
Human    74 IKEFDTKASVYQWSPETQGIIFSSINYGIILTLIPSGYLAGIFGAKKMLGAGLLISSLLTLFTPL 138

  Fly   109 CVAWGGWQAFCTIRIVEGLFQGLIFPCIHEHLAKWSPPEDRNRLGAFAYSGADCGSVLAMASSGL 173
            ...:|..... .:|.|:|:.||:.:.......|||:||.:|::|...|.||:..||.:.:...||
Human   139 AADFGVILVI-MVRTVQGMAQGMAWTGQFTIWAKWAPPLERSKLTTIAGSGSAFGSFIILCVGGL 202

  Fly   174 IANGSMGWPGIFYVSAGTCGLWCLLWVLFGANNAPSSRLIGSREREHIERSMKRQDGFHAQKIPI 238
            |:. ::.||.|||:...|..:.||||.....::......|..||:|||..|:.:|.....:.:||
Human   203 ISQ-ALSWPFIFYIFGSTGCVCCLLWFTVIYDDPMHHPCISVREKEHILSSLAQQPSSPGRAVPI 266

  Fly   239 PWRAIWSSSPFYALLVVRSAQGWANSTMQLQTPSYMHGVLEMDIKSNALYSALPFLAMWGMSYVY 303
              :|:.:..|.:|:.:...:..|..:.:....|:|:..:|.::|:.:.:.|:|||:|....:.:.
Human   267 --KAMVTCLPLWAIFLGFFSHFWLCTIILTYLPTYISTLLHVNIRDSGVLSSLPFIAAASCTILG 329

  Fly   304 LVFADVAMSRQWMSLTTLRKSINTVSYWGPAAALIGIGFLDKSQTTLAIALMTINAGLNAGSGIG 368
            ...||..:||..:.|.|:||..:::....|:...:.:.|: .|...:.|.|:.:..|.:.....|
Human   330 GQLADFLLSRNLLRLITVRKLFSSLGLLLPSICAVALPFV-ASSYVITIILLILIPGTSNLCDSG 393

  Fly   369 SILTIIDMSPNHSGMLMAIVNGIGNIFPLLTPLLVGVIVTESDSRSQWQIVFAMTAVVFFIGNLV 433
            .|:..:|::|.::..||.|..|.|.|..:::....|.:::: |..|.|:.||.::|.|...|.:.
Human   394 FIINTLDIAPRYASFLMGISRGFGLIAGIISSTATGFLISQ-DFESGWRNVFFLSAAVNMFGLVF 457

  Fly   434 YLIWGTTDQQAWDAE 448
            ||.:|..:.|.|..|
Human   458 YLTFGQAELQDWAKE 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7881NP_001286144.1 2A0114euk 12..449 CDD:129972 128/463 (28%)
MFS 18..437 CDD:119392 122/444 (27%)
SLC17A2NP_001273052.1 2A0114euk 1..477 CDD:129972 131/470 (28%)
MFS 81..461 CDD:119392 110/385 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148655
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.