DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7882 and ERDL6

DIOPT Version :9

Sequence 1:NP_610189.2 Gene:CG7882 / 35520 FlyBaseID:FBgn0033047 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_177658.1 Gene:ERDL6 / 843859 AraportID:AT1G75220 Length:487 Species:Arabidopsis thaliana


Alignment Length:429 Identity:113/429 - (26%)
Similarity:208/429 - (48%) Gaps:38/429 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 DAGLEIL-WSAIVSIFLVGGAIGSVVGATMANRFGRRGCFFICGL--LLGLGAISFYACRPLRSV 148
            |.||.:. :|...|:..||..:|::....:|...||:|...|..:  ::|...|||     .:..
plant    79 DLGLTVSEYSVFGSLSNVGAMVGAIASGQIAEYIGRKGSLMIAAIPNIIGWLCISF-----AKDT 138

  Fly   149 ELLLLGRMMVGLAGGLLTSFMSMWHSEISALSQRSTLAPLCPMGLTLGVVIAQVCSLRSVLGGPE 213
            ..|.:||::.|...|:::..:.::.:||:..:.|..|..:..:.:|:|:::|.      :||...
plant   139 SFLYMGRLLEGFGVGIISYTVPVYIAEIAPQNMRGGLGSVNQLSVTIGIMLAY------LLGLFV 197

  Fly   214 NWHFGLAFYGLLVLVCYAPFRWY-PESPKWLFIVQGRKEDARRQLQLLRGYTAGSAALKAEMEEM 277
            .|.. ||..|:|......|..:: ||||:|| ...|..::....||:|||:   ...:..|:.|:
plant   198 PWRI-LAVLGILPCTLLIPGLFFIPESPRWL-AKMGMTDEFETSLQVLRGF---ETDITVEVNEI 257

  Fly   278 EQESACEVKTSSLMQV-LRDPQLRLPLIIVCAFLGGQQLSGINAIFYYSVSIFRKAGLSSQASEW 341
            ::..|...|.:::..| |:..:...||::....|..|||.|||.:.:||.:||..||::|  |..
plant   258 KRSVASSTKRNTVRFVDLKRRRYYFPLMVGIGLLVLQQLGGINGVLFYSSTIFESAGVTS--SNA 320

  Fly   342 ANLGAGSLNLFASMLGPVLLERVNRRPLMLFSTFFCAVFLLLFAIMLFFIE-------SYSWFGM 399
            |..|.|::.:.|:.:...|:::..||.|:..|:....:.|::.|...:..|       .|||..:
plant   321 ATFGVGAIQVVATAISTWLVDKAGRRLLLTISSVGMTISLVIVAAAFYLKEFVSPDSDMYSWLSI 385

  Fly   400 GCIGCIFLYIFFFQFGLGPMPFFIGAELFELATRPAAMSLGSLAYWLCNFIIGMAFPTMQNL--- 461
            ..:..:...:.||..|:||:|:.|.:|:..:..:..|.|:.:||.|..:::|.|.    .||   
plant   386 LSVVGVVAMVVFFSLGMGPIPWLIMSEILPVNIKGLAGSIATLANWFFSWLITMT----ANLLLA 446

  Fly   462 WGA-LVFLPFSVTCLLIFGLTKRYLPETRGRHPSEVAPL 499
            |.: ..|..:.:.|.........::|||:|:...|:..|
plant   447 WSSGGTFTLYGLVCAFTVVFVTLWVPETKGKTLEELQSL 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7882NP_610189.2 Sugar_tr 43..491 CDD:278511 110/419 (26%)
MFS 95..480 CDD:119392 104/399 (26%)
ERDL6NP_177658.1 MFS_GLUT6_8_Class3_like 49..481 CDD:340916 111/423 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.