DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7882 and Slc2a6

DIOPT Version :9

Sequence 1:NP_610189.2 Gene:CG7882 / 35520 FlyBaseID:FBgn0033047 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001100032.1 Gene:Slc2a6 / 296600 RGDID:1309317 Length:321 Species:Rattus norvegicus


Alignment Length:312 Identity:73/312 - (23%)
Similarity:131/312 - (41%) Gaps:39/312 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 PENWHFGLAFYG---LLVLVCYAPFRWYPESPKWLFIVQGRKEDARRQLQLLRGYTAGSAALKAE 273
            |..|   ||..|   :||::....|  .|.||::| :.:.|.|:|.:.|..||    ..:.:..|
  Rat     9 PWRW---LAVAGEGPVLVMILLLSF--MPNSPRFL-LSKSRDEEALQALIWLR----ADSEVHWE 63

  Fly   274 MEEMEQESACEVKTSSLMQVLRDPQLRLPLIIVCAFLGGQQLSGINAIFYYSVSIFRKAGLSSQA 338
            .|:::.....:....|..:.. :|::..|::|.......|||:||..|..|..:||....:...:
  Rat    64 FEQIQDNVRRQSSRVSWAEAW-EPRVYRPILITVLMRFLQQLTGITPILVYLQTIFDSTSVVLPS 127

  Fly   339 SEWANLGAGSLNLFASMLGPVLLERVNRRPLMLFSTFFCAVFLLLFAIMLFFI------------ 391
            .:.|.: .|::.|.:.::..|.::...|:.|:..|.....|..|...:.:..:            
  Rat   128 QQDAAI-VGAVRLLSVLIAAVTMDLAGRKVLLYVSASIMFVANLTLGLYVQLVPRTLTPNSTVEI 191

  Fly   392 -----------ESYSWFGMGCIGCIFLYIFFFQFGLGPMPFFIGAELFELATRPAAMSLGSLAYW 445
                       .::::..:..:....|:|..:..|.||:.:.:.:|:..|..|..|..|..|..|
  Rat   192 VTLGGTEQPPAAAFNYLTLIPLLATMLFIMGYAMGWGPITWLLMSEVLPLRARGVASGLCVLVSW 256

  Fly   446 LCNFIIGMAFPTMQNLWGALV-FLPFSVTCLLIFGLTKRYLPETRGRHPSEV 496
            |..|::...|....|.:|..| |..||..|||....|...:||||||...::
  Rat   257 LTAFVLTKYFLLAVNAFGLQVPFFFFSAICLLSLLFTGCCVPETRGRSLEQI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7882NP_610189.2 Sugar_tr 43..491 CDD:278511 71/305 (23%)
MFS 95..480 CDD:119392 66/294 (22%)
Slc2a6NP_001100032.1 MFS <89..293 CDD:119392 44/204 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337993
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.