DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Serpina3a

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_001161177.1 Gene:Serpina3a / 74069 MGIID:1921319 Length:422 Species:Mus musculus


Alignment Length:368 Identity:88/368 - (23%)
Similarity:164/368 - (44%) Gaps:74/368 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1676 DEDLQ----SFARLCNELAFSYWRAITSEKISSARSLVISPFALTSMLSMVFLGARGSTSGEMNE 1736
            |.::|    :.|.:..:.|||.::.:..:  :..:::|.||.::::.|:::.|||:.:|..|:.|
Mouse    39 DHEIQLDSVTLASINTDFAFSLYKKLALK--NPHKNIVFSPLSISAALALMSLGAKDNTLEEILE 101

  Fly  1737 ILKLDDMVTFNP----HLIFKNITNSVEQASDSDIATAAFVREIFSDRANGKILPFFKEKTQQLY 1797
            .||.:  :|..|    |..|.::...:.|..:.....|.  ..:|.|: :.:||..||||.:.||
Mouse   102 GLKFN--LTETPEADIHQNFGHLLQMLIQPENQVQINAG--NALFIDK-HLQILTEFKEKARALY 161

  Fly  1798 AGHVEEVNFH-------VVNDIVRRRTNLLVK-------RHTMGKVLEYLRTNSVWVNGPLATIS 1848
            .......:|.       ::||.||::|...:|       |:|...::.:|.....|         
Mouse   162 KAEAFTADFQLPREATKLINDYVRKQTQGKIKELVSDLHRNTSMALVNFLNFQGFW--------- 217

  Fly  1849 ANLFQTDCSHGSTTDRDGEMFFQVHPTVRQRRLVPIPAVLYRSGFLAGY--EPSLDATVVSFGRV 1911
                        ....|.|..|..:.|:.::|.|.:| ::........|  :..:.:||:....:
Mouse   218 ------------NVTFDPEDTFLGNFTLDRKRTVNVP-MMKTEELTTNYFRDEEMQSTVMELNYI 269

  Fly  1912 QNTVSTVYVMPGHQSSISPMDNLDRLERSLVETAFSDKQAWRRLLTSLMDRPGM--EVQLPRFSH 1974
            .| .|.::::|       ....:..:|.||...:.   :.||:.|     ||.|  |:.||:||.
Mouse   270 GN-ASFLFILP-------DQGRIQHVEDSLQPQSL---RKWRKSL-----RPRMLDELSLPKFSL 318

  Fly  1975 RSFVNASLGLQKMGLRGLFKSDFADLRGLTGAGNRDIFLSDMI 2017
            ....|.:..|.::|::.:|.:. |||.|:|||.|  |.:|.||
Mouse   319 SQDYNLNDILPELGIKEVFSTQ-ADLSGITGAKN--IRVSQMI 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 85/353 (24%)
Serpina3aNP_001161177.1 SERPIN 53..416 CDD:294093 85/354 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.