DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Serpine3

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:XP_006252257.2 Gene:Serpine3 / 691375 RGDID:1585042 Length:413 Species:Rattus norvegicus


Alignment Length:476 Identity:92/476 - (19%)
Similarity:176/476 - (36%) Gaps:136/476 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1685 LCNELAFSYWRAITSEKISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEILKL---DDMVTF 1746
            |..|.|...:::..:|  ::..:.||||.:::..|.::...|||:|..::.|.|..   |..|..
  Rat    31 LKTEFALHLYQSAAAE--TNGTNFVISPASVSLSLEILQFAARGNTGWQLAEALGYTVQDPRVRE 93

  Fly  1747 NPHLIFKNITNSVEQASDSDIATAAFVREIFSDRANGKILPFFKEKTQQLYAGHVEEVNFHVVND 1811
            ..|.::..:.|| .|....::|...|:      :....:.|.|.|:..:.....:|..:|...| 
  Rat    94 FLHTVYITLHNS-SQGIGMELACTLFM------QTGTSLSPCFVEQVSRWANSSLELADFSEPN- 150

  Fly  1812 IVRRRTNLLVKRHTMGKVLEYLRTNSVW-----VNGPLATISANLFQTD---------------- 1855
                .|.:...:.|..........:.:|     ::..|:.:|...||:.                
  Rat   151 ----TTTMEASKGTTRPSTGEGPGSPLWGRAGALSTQLSIVSTMTFQSSWQQRFSSVALQPLPFT 211

  Fly  1856 CSHGSTTDRDGEMFFQVHPTVRQRRLVPIPAVLY-RSGFLAGYEPSLDATVVSFGRVQNTVSTVY 1919
            |:||        :..|| |.:.|     :..|.| :....||::..: ..::..|||   .|.:.
  Rat   212 CAHG--------LVLQV-PAMHQ-----VAEVSYGQFQDAAGHKVDV-LELLYLGRV---ASLLL 258

  Fly  1920 VMPGHQSSISPMDNLD-RLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSFVNASLG 1983
            |:|  |...:|:|::: .|...::           .|.|:.:.|..|:|.||||..::..:....
  Rat   259 VLP--QDKGTPLDHIEPHLTARVI-----------HLWTTRLKRARMDVFLPRFRIQNQFDLKSI 310

  Fly  1984 LQKMGLRGLFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYPAPPLRKRN 2048
            |:..|:..||....|:|:|::|   ||.|.                :||..|            .
  Rat   311 LRSWGITDLFDPLKANLKGISG---RDGFY----------------VSEVTH------------K 344

  Fly  2049 KDVDATDDDAFDSSERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQARVPDAPRLRFD 2113
            ..::.:::.....:...|                              |..|::|   .|..:.|
  Rat   345 AKMELSEEGTKSCAATAV------------------------------LLLRRSR---TPAFKAD 376

  Fly  2114 KPFLYFVR-HNPTGMILFMGR 2133
            :||::.:| ||...:.:..|:
  Rat   377 RPFIFLLREHNTVAVRITHGK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 91/474 (19%)
Serpine3XP_006252257.2 serpin 20..400 CDD:422956 92/476 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.