DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Serpina12

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_080811.1 Gene:Serpina12 / 68054 MGIID:1915304 Length:413 Species:Mus musculus


Alignment Length:480 Identity:93/480 - (19%)
Similarity:184/480 - (38%) Gaps:131/480 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1677 EDLQSFARLCNELAFSYWRAITSEKISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEILKLD 1741
            :|.:..||...|..|...:.:.|.  |...::.:||.::::..||:.|||:.||..|:.|.....
Mouse    43 KDARQLARHNMEFGFKLLQRLASN--SPQGNIFLSPLSISTAFSMLSLGAQNSTLEEIREGFNFK 105

  Fly  1742 DMVTFNPHLIFKNITNSVEQASDS---DIATAAFVREIFSDRANGKILP--FFKEKTQQLYAGHV 1801
            :|..::.|..|..:.:.:.|.::.   ::..|.|:.:        |:.|  .|....:.:|...:
Mouse   106 EMSNWDVHAAFHYLLHKLNQETEDTKMNLGNALFMDQ--------KLRPQQRFLNLAKNVYDADM 162

  Fly  1802 EEVNFH-------VVNDIVRRRTNL----LVKRHTMGKVLEYLRTNSVWVNGPLATISANLFQTD 1855
            ...||.       .:|..:.::|:.    :||....|.|:  :.||.::..|        .:|.:
Mouse   163 VLTNFQDLENTQKDINRYISQKTHSRIKNMVKSIDPGTVM--ILTNYIYFRG--------RWQYE 217

  Fly  1856 CSHGSTTDRDGEMFFQVHPTVRQRRLVPIPAVLYRSGFLAGYEPSLDATVVSFGRVQNTVSTVYV 1920
            .....|.:   |.||     :.:.:.|.:|.:..|..:...|:..|..|::.. ..:..::..:|
Mouse   218 FDPKQTKE---EEFF-----IEKGKTVKVPMMFQRGLYDMAYDSQLSCTILEI-PYRGNITATFV 273

  Fly  1921 MPGHQSSISPMDN--LDRLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSFVNASLG 1983
            :|         ||  |..||:.|....|:   .|:    ||:.:..::|.:|:....|..|....
Mouse   274 LP---------DNGKLKLLEQGLQADIFA---KWK----SLLSKRVVDVWVPKLRISSTYNMKKV 322

  Fly  1984 LQKMGLRGLFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYPAPPLRKRN 2048
            |.::|:..:|:.            |.|:                .:||.|..:::          
Mouse   323 LSRLGISKIFEE------------NGDL----------------TRISSHRSLKV---------- 349

  Fly  2049 KDVDATDDDAFDSSERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQARVPDAPR-LRF 2112
                   .:|...:|..:|...:  |.|.|.|           ...||:        :.|| ::.
Mouse   350 -------GEAVHKAELKMDEKGM--EGAAGSG-----------AQTLPM--------ETPRHMKL 386

  Fly  2113 DKPFLYFVRHNPTGMILFMGR-FNP 2136
            |:|||..:..|....::|:.| ::|
Mouse   387 DRPFLMMIYENFMPSMVFLARIYDP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 89/468 (19%)
Serpina12NP_080811.1 alpha-1-antitrypsin_like 51..408 CDD:239011 88/467 (19%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 6/38 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.