DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and SERPINE3

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_001094790.1 Gene:SERPINE3 / 647174 HGNCID:24774 Length:424 Species:Homo sapiens


Alignment Length:552 Identity:116/552 - (21%)
Similarity:183/552 - (33%) Gaps:211/552 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1638 PPLLINLMASSTQSTRPPVKLDPSPESSQGLEASTAMMDED----LQSFARLCNELAFSYWRAIT 1698
            ||.||.|....:...|....|         .|..|.:..|.    .||.|...||..|       
Human     2 PPFLITLFLFHSCCLRANGHL---------REGMTLLKTEFALHLYQSVAACRNETNF------- 50

  Fly  1699 SEKISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEIL-------KLDDMVTFNPHLIFKNIT 1756
                      ||||..::..|.::..||.|||..::.:.|       ::.|.:    |.::..:.
Human    51 ----------VISPAGVSLPLEILQFGAEGSTGQQLADALGYTVHDKRVKDFL----HAVYATLP 101

  Fly  1757 NSVEQASDSDIATAAFVREIFSDRANGKILPFFKE-----KTQQLYAGHVEEVNFHVVNDIVRRR 1816
            .| .|.::.::|.:.||      :....:.|.|.|     ....|....:.|.|...:      :
Human   102 TS-SQGTEMELACSLFV------QVGTPLSPCFVEHVSWWANSSLEPADLSEPNSTAI------Q 153

  Fly  1817 TNLLVKRHTMGKVLEYLRTNSVWVNGP------------------LATISANLFQ-TDCSHGSTT 1862
            |:....|.|.|             .||                  |..:|...|| |.....|:|
Human   154 TSEGASRETAG-------------GGPSEGPGGWPWEQVSAAFAQLVLVSTMSFQGTWRKRFSST 205

  Fly  1863 DRDGEMFFQVHPTVRQRRLVPIPAVLYRSGFLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQ-- 1925
            |.      |:.|......||....:::::            |.|::|:.|:|.       |||  
Human   206 DT------QILPFTCAYGLVLQVPMMHQT------------TEVNYGQFQDTA-------GHQVG 245

  Fly  1926 --------SSIS-----PMDN---LDRLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSH 1974
                    |::|     |.|.   |..:|..|..:..       .|.|:.:.|..|:|.||||..
Human   246 VLELPYLGSAVSLFLVLPRDKDTPLSHIEPHLTASTI-------HLWTTSLRRARMDVFLPRFRI 303

  Fly  1975 RSFVNASLGLQKMGLRGLFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHH---V 2036
            ::..|....|...|:..||....|:|:|::|   :|.|.                :||..|   :
Human   304 QNQFNLKSILNSWGVTDLFDPLKANLKGISG---QDGFY----------------VSEAIHKAKI 349

  Fly  2037 EMYPAPPLRKRNKDVDATDDDAFDSSERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQ 2101
            |:     |.:..|...||                     ||                   |..::
Human   350 EV-----LEEGTKASGAT---------------------AL-------------------LLLKR 369

  Fly  2102 ARVPDAPRLRFDKPFLYFVRHNPTGMILFMGR 2133
            :|:   |..:.|:||:||:|...||:.:|..|
Human   370 SRI---PIFKADRPFIYFLREPNTGITVFFDR 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 103/499 (21%)
SERPINE3NP_001094790.1 SERPIN 31..399 CDD:238101 107/514 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..174 8/49 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.