DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and SERPINA4

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_001275961.1 Gene:SERPINA4 / 5267 HGNCID:8948 Length:464 Species:Homo sapiens


Alignment Length:545 Identity:104/545 - (19%)
Similarity:196/545 - (35%) Gaps:185/545 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1640 LLINLMASS-----------TQSTRPPVKLDPSPESSQGLEASTAMMDEDLQSFARLCNELAFSY 1693
            ||:.|:|.|           :.|.....::..:.|.|..|:.:.|..|            .||.:
Human    47 LLVGLLALSHGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANAD------------FAFRF 99

  Fly  1694 WRAITSEKISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEIL--KLDDMVTFNPHLIFKNIT 1756
            :..|.||  :..:::..||.::::..:|:.|||...:..::.|.|  .|.::...:.|..|:::.
Human   100 YYLIASE--TPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLL 162

  Fly  1757 NSVE---QASDSDIATAAFVREIFSDRANGKILPFFKEKTQQLYAGHVEEVNFH-------VVND 1811
            :::.   ...::.:.:|.|:..      |.|.|..|...|..:|...:...||:       ::||
Human   163 HTLNLPGHGLETRVGSALFLSH------NLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLIND 221

  Fly  1812 IVRRRT-----NLL--VKRHTMGKVLEYLRTNSVWVNGPLATISANLFQTDCSHGSTTDRDGEMF 1869
            .|::.|     :|:  :|:..:..::.|:...::|....:::             .||.:|  .:
Human   222 HVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISS-------------RTTPKD--FY 271

  Fly  1870 FQVHPTVRQRRLVP----------------IPAVLYRSGFLAGYEPSLDATVVSFGRVQNTVSTV 1918
            ...:.|||    ||                :|..:.|..:..      ||||            .
Human   272 VDENTTVR----VPMMLQDQEHHWYLHDRYLPCSVLRMDYKG------DATV------------F 314

  Fly  1919 YVMP--GHQSSISPMDNLDRLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFS-HRSFVNA 1980
            :::|  |....|..:...:.|.|            |..||........:|:.||:|| ..|:|..
Human   315 FILPNQGKMREIEEVLTPEMLMR------------WNNLLRKRNFYKKLELHLPKFSISGSYVLD 367

  Fly  1981 SLGLQKMGLRGLFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKI--SEHHHVEMYPAPP 2043
            .: |.::|...|| |.:|||.|:|                     .::|:  |:..|        
Human   368 QI-LPRLGFTDLF-SKWADLSGIT---------------------KQQKLEASKSFH-------- 401

  Fly  2044 LRKRNKDVDATDDDAFDSSERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQARVPDAP 2108
              |...|||....:|..::...:.|.|......:                               
Human   402 --KATLDVDEAGTEAAAATSFAIKFFSAQTNRHI------------------------------- 433

  Fly  2109 RLRFDKPFLYFVRHNPTGMILFMGR 2133
             |||::|||..:....|..:||:|:
Human   434 -LRFNRPFLVVIFSTSTQSVLFLGK 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 93/487 (19%)
SERPINA4NP_001275961.1 alpha-1-antitrypsin_like 91..458 CDD:239011 95/501 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.