DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and SERPINE1

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_001373389.1 Gene:SERPINE1 / 5054 HGNCID:8583 Length:492 Species:Homo sapiens


Alignment Length:485 Identity:107/485 - (22%)
Similarity:178/485 - (36%) Gaps:166/485 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1683 ARLCNELAFSYWRAITSEKISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEIL--KLDD--M 1743
            |.|.::.....::.:.  :.|..|::|.||:.:.|:|:|:.|...|.|..::...:  |:||  |
Human    32 AHLASDFGVRVFQQVA--QASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAMGFKIDDKGM 94

  Fly  1744 VTFNPHLIFKNITN--SVEQASDSDIATAAFV-REIFSDRANGKILPFFKEKTQQLYAGHVEEVN 1805
            .....|| :|.:..  :.::.|.:|   |.|| |::       |::..|.....:|:...|::|:
Human    95 APALRHL-YKELMGPWNKDEISTTD---AIFVQRDL-------KLVQGFMPHFFRLFRSTVKQVD 148

  Fly  1806 F-------HVVNDIVRRRT-----NLLVKRHTMGKVLEYLR---TNSVWVNG------PLATISA 1849
            |       .::||.|:..|     |||.|    |.|.:..|   .|:::.||      |.::...
Human   149 FSEVERARFIINDWVKTHTKGMISNLLGK----GAVDQLTRLVLVNALYFNGQWKTPFPDSSTHR 209

  Fly  1850 NLFQTDCSHGSTTDRDGEMFFQVHPTVRQRRLVPIPAVLYRSGFLAGYEPSLDATVVSFGRVQNT 1914
            .||..  |.|||                    |.:|.:...:.|          ....|......
Human   210 RLFHK--SDGST--------------------VSVPMMAQTNKF----------NYTEFTTPDGH 242

  Fly  1915 VSTVYVMPGHQSSIS-----------PMDNLDR-LERSLVETAFSDKQAWRRLLTSLMDRPGMEV 1967
            ...:..:|.|..::|           |:..|.. |...|:       ..|:..:|.|   |.:.|
Human   243 YYDILELPYHGDTLSMFIAAPYEKEVPLSALTNILSAQLI-------SHWKGNMTRL---PRLLV 297

  Fly  1968 QLPRFSHRSFVNASLGLQKMGLRGLFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISE 2032
             ||:||..:.|:....|:.:|:..:|:...||...          |||               .|
Human   298 -LPKFSLETEVDLRKPLENLGMTDMFRQFQADFTS----------LSD---------------QE 336

  Fly  2033 HHHVEMYPAPPLRKRNKDVDATDDDAFDSSERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPL 2097
            ..||    |..|:|...:|:.:...|..|:..:|                               
Human   337 PLHV----AQALQKVKIEVNESGTVASSSTAVIV------------------------------- 366

  Fly  2098 RPRQARVPDAP-RLRFDKPFLYFVRHNPTG 2126
               .||:  || .:..|:|||:.|||||||
Human   367 ---SARM--APEEIIMDRPFLFVVRHNPTG 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 105/481 (22%)
SERPINE1NP_001373389.1 serpinE1_PAI-1 29..393 CDD:381007 107/485 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.