DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Spn42Da

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster


Alignment Length:511 Identity:104/511 - (20%)
Similarity:175/511 - (34%) Gaps:160/511 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1654 PPVKLDPSPESSQGLEASTAMMDEDLQSFARLCNELAFSYWRAITSEKISSARSLVISPFALTSM 1718
            |||.           .|...|.|...|.|||.....:.:.:..::.:|  ...::|.|||::.:.
  Fly    24 PPVH-----------TADVTMADAAHQEFARRLALFSINVYGKLSGQK--PGENIVFSPFSIQTC 75

  Fly  1719 LSMVFLGARGSTSGEMNEILKLDDMVTFNPHLI---FKNITNSVEQASDSDIATAAFVREIFSDR 1780
            .:|..|||...|:.::::.|.|   .:.:|..|   |..:..:.:.:....||...||.:.:..|
  Fly    76 AAMARLGAENETATQLDQGLGL---ASSDPEQIAHSFHQVLAAYQDSQILRIANKIFVMDGYQLR 137

  Fly  1781 ANGKILPFFKEKTQQLYAGHVEEVNFH-------VVNDIVRRRTNLLVKRHTMGKVLEYLRTNSV 1838
            ..      |.:...:.:....:.|:|.       .:|:.|.:|||.|:|......||     || 
  Fly   138 QE------FDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVL-----NS- 190

  Fly  1839 WVNGPLATISANLFQTDCSH--------GSTTDRDGEMFFQVHPTVRQRRLVPIPAVLYRSGFLA 1895
              ...|..::|..|:....|        ..|...|||            |.|.:|.:..:..|..
  Fly   191 --ESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGE------------RTVQVPMMSLKERFRY 241

  Fly  1896 GYEPSLDATVVSFGRVQNTVSTVYVMPGHQSSISPMD------NLDRLERSLVETAFSDKQAWRR 1954
            ...|:|||..:......:.:|.:.|:|..::.:..::      .|.::.:||.||.         
  Fly   242 ADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETK--------- 297

  Fly  1955 LLTSLMDRPGMEVQLPRFSHRSFVNASLGLQKMGLRGLFKSDFADLRGLTGAGNRDIFLSDMIQI 2019
                      :.::||||.....|..|...||:|:..:|                    ||..:.
  Fly   298 ----------VALKLPRFKAEFQVELSEVFQKLGMSRMF--------------------SDQAEF 332

  Fly  2020 NTFSTCGEEKISEHHHVEMYPAP-PLRKRNKDVDATDDDAF-----DSSERVVDFGSLVQESALG 2078
            .                :|..:| ||:     |.|....||     :.:|.....|..|:     
  Fly   333 G----------------KMLQSPEPLK-----VSAIIHKAFIEVNEEGTEAAAATGMAVR----- 371

  Fly  2079 RGFYDDLLDPKYLELPLPLRPRQARVPDAPRLRF--DKPFLYFVRHNPTGMILFMG 2132
                               |.|....|:.| :.|  |.||.|.:.|. ..:.||.|
  Fly   372 -------------------RKRAIMSPEEP-IEFFADHPFTYVLVHQ-KDLPLFWG 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 94/478 (20%)
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 94/479 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.