DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Spn27A

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster


Alignment Length:562 Identity:105/562 - (18%)
Similarity:185/562 - (32%) Gaps:201/562 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1640 LLINLMAS--------STQSTRPP-----VKLDPSPESSQGLEASTAMMDEDLQSFA--RLCNEL 1689
            :|::|..|        |..:|..|     .:.|..|..:..:.:...:.| |:.:|.  |..:..
  Fly    11 MLLSLFLSALATGNGNSIPTTTTPQGVFETRTDKLPGGAASVPSGAGIYD-DIDTFVPFRSDSHD 74

  Fly  1690 AFSYWRAITS--EKISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEILKLDDMVTFNPHLIF 1752
            .|| |..:.:  :..::.::::||||::..:|:::   |..:.:|...::               
  Fly    75 PFS-WHLLKTVLQNETADKNVIISPFSVKLVLALL---AEAAGAGTQTQV--------------- 120

  Fly  1753 KNITNSVEQASDSDIATAAFVREIFSDRANGKILPFFKE-------------------KTQQ--- 1795
             .:.|     :.:||.:...|||.:....|.    |.||                   :|||   
  Fly   121 -ELAN-----TQTDIRSQNNVREFYRKTLNS----FKKENQLHETLSVRTKLFTDSFIETQQKFT 175

  Fly  1796 -----LYAGHVEEVNF---HVVNDIVRRRTNLLVKRHTMGKVLE-----------YLRTNSVWVN 1841
                 .|...||.::|   ....|.:    |......|.|::.:           .|.||.::.|
  Fly   176 ATLKHFYDSEVEALDFTNPEAAADAI----NAWAANITQGRLQQLVAPDNVRSSVMLLTNLIYFN 236

  Fly  1842 GPLATISANLFQTDCSHGSTTDRDGEMFFQV---HPTVRQRRLVPIPAVLYRSGFLAGYEPSLDA 1903
            |......|..||.............|...|.   :.|..::....|..:.|:             
  Fly   237 GLWRRQFATTFQGSFFRSKDDQSRAEFMEQTDYFYYTTSEKLKAQILRLPYK------------- 288

  Fly  1904 TVVSFGRVQNTVSTVYVMPGHQSSISPMDNLDRLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQ 1968
                 |:....|...|.:.|....:..::| |.|:.:          .|      .|:...::|.
  Fly   289 -----GKNSLFVLLPYALNGIHDLVKNLEN-DELKSA----------QW------AMEEVKVKVT 331

  Fly  1969 LPRFSHRSFVNASLGLQKMGLRGLFKSDFADLRGLTG----AGNRDIFLSDMIQ---INTFSTCG 2026
            ||:|......|....|:.:|:|.:|: |.|.|.|||.    ||.  :.:|:::|   ||.     
  Fly   332 LPKFHFDYQQNLKETLRSLGVREIFE-DSASLPGLTRGADVAGK--VKVSNILQKAGINV----- 388

  Fly  2027 EEKISEHHHVEMYPAPPLRKRNKDVDATDDDAFDSSERVVDFGSLVQESALGRGFYDDLLDPKYL 2091
            .||     ..|.|.|..:...||         |..|..:.:|                       
  Fly   389 NEK-----GTEAYAATVVEIENK---------FGGSTAIEEF----------------------- 416

  Fly  2092 ELPLPLRPRQARVPDAPRLRFDKPFLYFVRHNPTGMILFMGR 2133
                               ..::||::|:....||.|||.|:
  Fly   417 -------------------NVNRPFVFFIEEESTGNILFAGK 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 93/500 (19%)
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 93/500 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.