DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Spn43Aa

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster


Alignment Length:452 Identity:94/452 - (20%)
Similarity:179/452 - (39%) Gaps:109/452 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1687 NELAFSYWRAITSEKISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEIL-----KLDDMVTF 1746
            |..|...::.:.:::  ...:::|||.::...|.:.:.||.|.|:.|:.:.|     :..|.:..
  Fly    28 NLFATELFQTLATDR--QDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDGLAE 90

  Fly  1747 NPHLIFKNITNS-VEQASDSDIATAAFVREIFSDRANGKILPFFKEKTQQLYAGHVEEVNFHVVN 1810
            :.|    |:.:| ::..:..:||...:.|:      |..:...|:|..|:.:...||.::|....
  Fly    91 SYH----NLLHSYIKSKTVLEIANKVYTRQ------NLTVSSHFREVAQKYFDSEVEPLDFSRET 145

  Fly  1811 DIVRRRTNLLVKRHTMGK---VLEYLR--TNSVWVNGPLATISANLFQTDCSH--GSTTDRDGEM 1868
            :.| .:.|..||:.|..|   |:|.|.  ||       :|.::|..|:...:.  .....||.|.
  Fly   146 EAV-EQINRWVKQQTENKIERVVESLEPDTN-------VALVNAIYFKARWARPFNDEDTRDREF 202

  Fly  1869 FFQVHPTVRQRRLVPIPAVLYRSGFLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQSSISPMD- 1932
            :      :.:.|.:.:|.:...:.:.....|.|||..:........::..:::|..:|.:..:: 
  Fly   203 W------LSESRSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQ 261

  Fly  1933 NLDRLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSFVNASLGLQKMGLRGLFKSDF 1997
            .|..::.:|:|    |:..|:          .:.|.||:|......:....|.|||:..:| ||.
  Fly   262 KLKGVDFNLLE----DRWQWQ----------SVSVYLPKFKFEFDTDLRPTLHKMGISAMF-SDA 311

  Fly  1998 ADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYPAPPLRKRNKDVDATDDDAFDSS 2062
            ||             .|::.|.:...|    :|::..|          |...||:....:|..:|
  Fly   312 AD-------------FSNIFQDSPIGT----RITKVQH----------KTFIDVNEIGCEAAGAS 349

  Fly  2063 ERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQ--ARVPDAPRLRFDKPFLYFVRH 2122
                        .|.|            :.:.|||.|:.  |..|.|..:| ||..:||..|
  Fly   350 ------------YAAG------------VPMSLPLDPKTFVADHPFAFIIR-DKHAVYFTGH 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 94/452 (21%)
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 94/452 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.