DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Spn85F

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_649965.2 Gene:Spn85F / 41221 FlyBaseID:FBgn0037772 Length:640 Species:Drosophila melanogaster


Alignment Length:324 Identity:83/324 - (25%)
Similarity:107/324 - (33%) Gaps:110/324 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 GSQIVVPQKPSRPQRPTSNPSITSTMPAQEVTT-----TTTTFKPVITSTE---PQTTEPPAEST 586
            |..:.|....|.|...||:..:.:|..|...||     .|||.|...::||   ..||||||   
  Fly   174 GYDLSVDMLSSTPANLTSDAELVNTTMASNTTTMEMDAETTTSKDAESTTEEPATTTTEPPA--- 235

  Fly   587 VTTTSEPEPTTTSSTQASTTTSTETYTTTSTE--------------------------------- 618
             |||:|| ||||:.|.|.|..:||....||.|                                 
  Fly   236 -TTTAEP-PTTTTETPAETEATTEAPAATSGEEEAAEPAGEDEAAELVSAFVAEEDSEPLLRIQK 298

  Fly   619 -----APTTTVTAPTTTS--IAP-------AKTTAIP-PALHHQKLHNKPANRPLSQQHNHGLGR 668
                 .||:.:.||...|  |.|       |:|.|:| |.:..|....||..             
  Fly   299 ARVSRLPTSKLQAPLKHSNPITPKPIYLPSARTVAMPMPMMARQVAERKPPG------------- 350

  Fly   669 PVHYTTTESSKIVGEPQTETYGIVYVIHSSTTTHKPFYPLPSYNDDAVQNVSTLLTP-PPVQHKP 732
                 |.:...|:. |..:...|.....:.|..:|. :.:|:|.|.......||..| ..|.|.|
  Fly   351 -----TRQVISIIA-PSVQPANISVTRKTKTARYKR-HAIPAYKDLDANLFLTLFNPHTHVPHHP 408

  Fly   733 LKKTPLPSLSQLQQQLHLGSPSPAPQLSPDQILSMDQIVQSLTQDLSASDKGEEASGASPVKYD 796
                           ||...|.|| ..:|            :|.|......||.|.|.|....|
  Fly   409 ---------------LHFPPPVPA-AFAP------------ITNDFEPHYIGEAAEGKSNYNTD 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093
Spn85FNP_649965.2 SERPIN 88..>204 CDD:294093 8/29 (28%)
SERPIN <450..634 CDD:294093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.