DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Acp76A

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster


Alignment Length:281 Identity:55/281 - (19%)
Similarity:97/281 - (34%) Gaps:96/281 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1595 GYNQLDMQPPKVLPYNA--NKADPVQLQVPIHSQSMLNQQRPSQRPPL-----LIN--LMASS-- 1648
            ||::...:   ||.:..  .||...:.|       |.|:...||:.||     |:|  ||.|:  
  Fly    76 GYSEARQE---VLDWGLRYKKASSAKFQ-------MANKVAVSQKLPLSQKLRLVNEVLMTSAKK 130

  Fly  1649 ---TQSTRPPVKLDPSPESSQGLEASTAMMDEDLQSFARLC------NELAFS------YWRAIT 1698
               |:..||...:|         |..::.:|..|.:|.:..      |.:|.|      .|.:..
  Fly   131 YDVTKDVRPSKLMD---------EWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHF 186

  Fly  1699 SEKIS----------------------------------SARSLVISPFALTSMLSMVFLGARGS 1729
            ..:|:                                  .|:.:.| ||:..::..::.|..:|.
  Fly   187 QSEINRYFVNNPGTGYASKDPTCVPMMHSLSSFETMSTDEAKGIYI-PFSSANLGMLILLPRKGV 250

  Fly  1730 TSGEMNEILKLDDMVTFNPHLIFKNITNSVEQASDSDIA---TAAFVREIFSDRANGKILPFFKE 1791
            |..::.:.|.....|.:|.|.....:....::..|.:||   ....:.:.|.|.|       ||.
  Fly   251 TCKDILDNLNNQINVEYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSA-------FKS 308

  Fly  1792 KTQQLYAGHVEEVNFHVVNDI 1812
            |.:      ::..||.|.:.|
  Fly   309 KAK------IKINNFRVNHGI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 29/169 (17%)
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 55/281 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.