DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Serpinb1c

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:XP_006516771.1 Gene:Serpinb1c / 380839 MGIID:2445363 Length:408 Species:Mus musculus


Alignment Length:470 Identity:113/470 - (24%)
Similarity:190/470 - (40%) Gaps:128/470 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1696 AITSEKISSARSL------------------VISPFALTSMLSMVFLGARGSTSGEMNEILKLDD 1742
            |.|..::|||.:|                  :.||.:::|.|:||:|||||||:.::::.|..|.
Mouse    31 AFTMGQLSSANNLFALELFHTLNESNPTGNTIFSPVSISSALAMVYLGARGSTAAQLSKTLHFDS 95

  Fly  1743 MVTFNPHLIFKNITNSVEQASDSDIATAAFVREIFSDRANGKILPFFKEKTQQLYAGHVEEVNFH 1807
            ....  |..|:::|..|.:...|.  |......::.::.. ..||.:....|:.|:..:..|:|.
Mouse    96 AEDI--HSQFQSLTAEVSKRGASH--TLKLANRLYGEKTY-NFLPEYLASIQKTYSADLALVDFQ 155

  Fly  1808 VVNDIVRRRTNLLVKRHTMGKVLEYL-------RTNSVWVNGPLATISANLFQTDCSHGSTTDRD 1865
            ..::..|:..|..||..|..|:.|..       .|..|.||   ||....::|.......|||..
Mouse   156 HASEDARKEINQWVKGQTEEKIQELFAVGVVDSMTKLVLVN---ATYFKGMWQKKFMARDTTDAP 217

  Fly  1866 GEMFFQVHPTVRQRRLVPIPAVLYRSGFLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQSSISP 1930
            ..:..:|..||:...|        ::....||.|.|...|:........:|.|.::|  :.....
Mouse   218 FRLSKKVTKTVKMMYL--------KNNLPFGYIPDLKCKVLEMPYQGGELSMVILLP--EDIEDE 272

  Fly  1931 MDNLDRLERSLVETAFSDKQAWRRLLTSLMDRPGME-----VQLPRFS-HRSFV-NASLGLQKMG 1988
            ...|:.:|:.|.             |..|.:...::     |:||:|. ..|:: |::||  ::|
Mouse   273 TTGLEEIEKQLT-------------LEKLQECENLQNIDVCVKLPKFKMEESYILNSNLG--QLG 322

  Fly  1989 LRGLFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYPAPPLRKRNKDVDA 2053
            ::.||.|..|||.|:  :|:||:|:|              ||....:||:           :.:.
Mouse   323 VQDLFSSSKADLSGM--SGSRDLFIS--------------KIVHKSYVEV-----------NEEG 360

  Fly  2054 TDDDAFDSSERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQARVPDAPRLRFDKPFLY 2118
            |:.||            .:..:.:|                ..|.|.:..|        |.|||:
Mouse   361 TETDA------------AMPGTVVG----------------CCLMPMEFTV--------DHPFLF 389

  Fly  2119 FVRHNPTGMILFMGR 2133
            |:|||||..:||:||
Mouse   390 FIRHNPTAHVLFLGR 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 113/470 (24%)
Serpinb1cXP_006516771.1 serpinB1_LEI 34..408 CDD:381028 111/467 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.