DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Spn53F

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster


Alignment Length:356 Identity:75/356 - (21%)
Similarity:132/356 - (37%) Gaps:84/356 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1718 MLSMVFLGA---RGSTSGEMNEILKLDDMVTFNPHLIFKNITNSVEQASDSDIATAAFVREIFSD 1779
            :|.::.||.   |...:.::.:.|....:.:|:.    :||..|.|....|.:.....|.|..|:
  Fly     3 VLLLILLGISRYRAQKNSQLPDELYAAIVNSFSN----RNIMFSTEMIRSSMLFIYVGVEEDESE 63

  Fly  1780 RA------NGKILPFFKEKTQQLYAGHVEE-------VNFHVVNDIVRRRTNLLVKRHTMGKV-- 1829
            :.      .|..|..:|.|||:::|..|::       ..|:|..::.......:..|||.|:.  
  Fly    64 QIRKAMHYRGTHLSEYKPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARN 128

  Fly  1830 LEYLRTNSVWVNGPLATISANLFQTDCSHGSTTDRDGEMFFQVHPTVRQRRLVP------IPAVL 1888
            :.:.|.....||            |..||        ||..|:...|::....|      :.|:.
  Fly   129 IAFAREQLDEVN------------TFYSH--------EMGEQIGQVVKESWWKPNSQGLLVNAIF 173

  Fly  1889 YRSGFLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQSSISPMDNLDRLERSLVETAFSDKQAWR 1953
            :...:...:.|  :||.....|| |...:|.:...|:.|......|..|:.:.|...||....  
  Fly   174 FNLSWERTFNP--EATYPREFRV-NATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDL-- 233

  Fly  1954 RLLTSLMDRPG------MEVQ-------------------LPRFSHRSFVNASLGLQKMGLRGLF 1993
            |:|....|:|.      |::|                   :|:|...|.:..|...:|||::.:|
  Fly   234 RMLLIKPDQPDGLAALQMKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIF 298

  Fly  1994 K--SDFADLRGLTGAGNRDIFLSDMIQINTF 2022
            |  ..|:.|.    ..|.:..:..:|.:.||
  Fly   299 KPSKSFSTLL----HRNTNFRIDGVIHVVTF 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 75/356 (21%)
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 71/334 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.