DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Spn28B

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster


Alignment Length:467 Identity:90/467 - (19%)
Similarity:170/467 - (36%) Gaps:132/467 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1693 YWRAITSEKISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEILKLDDMVTFNPHLIFKNITN 1757
            ::|.:.|:  ::.|:|:.||.:...::|||::.:.|.|..|:..:||..:    |..|:..|..:
  Fly    21 FYRILASQ--NAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSE----NKTLVANNYRS 79

  Fly  1758 SVEQASDSDIATAAFVREIF-----SDR--ANGK--ILPFFKEKTQQLYAGHVEEVNFH------ 1807
            .:     ||:..    ||.|     ::|  .|.|  ::|.|.:..::.:....:.:...      
  Fly    80 LL-----SDLKR----RETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSAS 135

  Fly  1808 -VVNDIVRRRTNLLVKRHTMGKVLEYLRTNSVWVNGPLATISANLFQTDCSHGSTTDRDGEMFFQ 1871
             :||..:..||..:::...:.|  ::....|.::      ::|..|:....:....|       |
  Fly   136 AIVNSWILNRTRGMIRNIVLPK--DFNSDTSAFL------VNAIYFKGQWLYNFKAD-------Q 185

  Fly  1872 VHPT---VRQRRLVPIPAVLYRSGFLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQSSISPMDN 1933
            .|..   |....::|:..:...:..|:||...:||.::......:|:|...::|         ::
  Fly   186 THIADFYVSANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILP---------NS 241

  Fly  1934 LDRLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSFVNASLGLQKMGLRGLFKSDFA 1998
            :|.|.:...:..|.|..         :::..:.|:||:|...|........:.:|:..:||.. |
  Fly   242 VDGLRKLKEKVGFIDYH---------LEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPS-A 296

  Fly  1999 DLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYPAPPLRKRNKDVDATDDDAFDSSE 2063
            ||.||.......|   |.|....|.     ||.|...........|.:|.|.:|           
  Fly   297 DLNGLVLESGAKI---DKIVQKAFL-----KIDEKGGEASAATGVLTRRKKSID----------- 342

  Fly  2064 RVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQARVPDAPRLRF--DKPFLYFVRHNPTG 2126
                  :|:|                                  |.:.|  |.||.|.:..|.  
  Fly   343 ------NLIQ----------------------------------PPMEFIADHPFFYVIHDNK-- 365

  Fly  2127 MILFMGRF-NPR 2137
            :|.|.|.. .||
  Fly   366 VIYFQGHIVEPR 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 88/464 (19%)
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 88/461 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.