DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and SERPINA9

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_783866.3 Gene:SERPINA9 / 327657 HGNCID:15995 Length:417 Species:Homo sapiens


Alignment Length:553 Identity:115/553 - (20%)
Similarity:204/553 - (36%) Gaps:183/553 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1617 VQLQVPIHSQSMLNQQRPSQRPPLLINLMASSTQSTRPPVKLDPSPESSQGLEASTAMMDEDLQS 1681
            |.|..||:..|..|......||        |||:||          .:||....:|         
Human    12 VGLCAPIYCVSPANAPSAYPRP--------SSTKST----------PASQVYSLNT--------- 49

  Fly  1682 FARLCNELAFSYWRAITSEKISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEILKLDDMVTF 1746
                  :.||..:|.:..|  :.::::..||.::::.|:|:.|||...|..::.:.|..:  :|.
Human    50 ------DFAFRLYRRLVLE--TPSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFN--LTH 104

  Fly  1747 NP----HLIFKNITNSVEQASDS---DIATAAFVREIFSDRANGKILPFFKEKTQQLYAGHVEEV 1804
            .|    |..|:::.:|:...|..   .:.:|.||::....:||      |....::||...|...
Human   105 TPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQAN------FLGNVKRLYEAEVFST 163

  Fly  1805 NFHVVNDIVRRRTNLLVKRHTMGKVLEYLR-----TNSVWVNGPLATISANLFQTDCSHGSTTDR 1864
            :|...: |.:.|.|..||:.|.|||::.::     |..|.||                       
Human   164 DFSNPS-IAQARINSHVKKKTQGKVVDIIQGLDLLTAMVLVN----------------------- 204

  Fly  1865 DGEMFFQV------HP---------TVRQRRLVPIPAVLYRSGFLAGYEPSLDATVVSFGRVQNT 1914
              .:||:.      ||         .|.::..|.:|.:..:..|..|.:..|:..|:......:.
Human   205 --HIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHVPMMHQKEQFAFGVDTELNCFVLQMDYKGDA 267

  Fly  1915 VSTVYVMPGHQSSISPMDNLDRL--ERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSF 1977
            |: .:|:|    |...|..|::.  .|:|.:.:.|.::.|            :||.:||||..:.
Human   268 VA-FFVLP----SKGKMRQLEQALSARTLRKWSHSLQKRW------------IEVFIPRFSISAS 315

  Fly  1978 VNASLGLQKMGLRGLFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYPAP 2042
            .|....|.|||::.:|..: ||..|        |...|.:|::..:......:||          
Human   316 YNLETILPKMGIQNVFDKN-ADFSG--------IAKRDSLQVSKATHKAVLDVSE---------- 361

  Fly  2043 PLRKRNKDVDATDDDAFDSSERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQARVPDA 2107
                     :.|:..|..:::.:|                                    |..|.
Human   362 ---------EGTEATAATTTKFIV------------------------------------RSKDG 381

  Fly  2108 P---RLRFDKPFLYFVRHNPTGMILFMGRF-NP 2136
            |   .:.|::.||..:.:..|..|||:|:. ||
Human   382 PSYFTVSFNRTFLMMITNKATDGILFLGKVENP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 97/481 (20%)
SERPINA9NP_783866.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.