DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Serpine3

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:XP_017171543.1 Gene:Serpine3 / 319433 MGIID:2442020 Length:404 Species:Mus musculus


Alignment Length:430 Identity:91/430 - (21%)
Similarity:156/430 - (36%) Gaps:90/430 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1685 LCNELAFSYWRAITSEKISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEILKL---DDMVTF 1746
            |..|.|...:|:..:|:  :..:.||||.:::..|.::..||||:|..::...|..   |..|..
Mouse    31 LKTEFALHLYRSAAAER--NGTNFVISPASVSLSLEILQFGARGNTGWQLAGALGYTVQDPRVKE 93

  Fly  1747 NPHLIFKNITNSVEQASDSDIATAAFVREIFSDRANGKILPFFKEKTQQLYAGHVEEVNFHVVND 1811
            ..|.::....|| .|....::|...|:      :....:.|.|.|:..:.....:|..:|...|.
Mouse    94 FLHAVYTTRHNS-SQGVGMELACTLFM------QTGTSLSPCFVEQVSRWANSSLEAADFSEPNS 151

  Fly  1812 IVRRRTNLLVKRHTMGKVLEYLRTNSVWVNGPLATI--SANLFQTDCSHGSTTDRDGEMFFQVHP 1874
            .....:. :..|.:.|:             ||.:.:  .|:...|..|..||      |.||   
Mouse   152 TTTEASK-VTSRQSTGE-------------GPDSPLWGRADALSTQLSIMST------MTFQ--- 193

  Fly  1875 TVRQRR----LVPIPAVLYRSGFLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQSS-------- 1927
            :..|:|    |.|:| ..:..|.:...........||:|:.|:..       ||:.:        
Mouse   194 STWQKRFSVVLQPLP-FTHAHGLVLQVPAMHQVAEVSYGQFQDAA-------GHEIAVLELLYLG 250

  Fly  1928 -------ISPMDN---LDRLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSFVNASL 1982
                   :.|.|.   ||.:|..|.....       .|.|:.:.|..|:|.||||..::..:...
Mouse   251 RVASLLLVLPQDKGTPLDHIEPHLTARVL-------HLWTTRLKRARMDVFLPRFKIQNQFDVKS 308

  Fly  1983 GLQKMGLRGLFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYPAPPLRKR 2047
            .|:..|:..||....|:|:|::|        .|...::..:...:.::||...........|..|
Mouse   309 ILRSWGITDLFDPLKANLKGISG--------QDGFYVSQLTHKAKMELSEEGTRSSAATAVLLLR 365

  Fly  2048 NKDVDATDDDAFDSSERVVDFGSLVQESALGRGFYDDLLD 2087
            .....|...|.        .|..|::|.:.|..|....||
Mouse   366 RSRTSAFKADR--------PFIFLLREHSTGTDFLKKKLD 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 90/428 (21%)
Serpine3XP_017171543.1 serpin 20..388 CDD:393296 87/419 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.