DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and SERPIND1

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_000176.2 Gene:SERPIND1 / 3053 HGNCID:4838 Length:499 Species:Homo sapiens


Alignment Length:469 Identity:93/469 - (19%)
Similarity:179/469 - (38%) Gaps:124/469 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1688 ELAFSYWRAITSEKISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEILKLDDMVTFNP---- 1748
            :.||:.:| :..:::::..::.|:|..:::.:.|:.||.:|.|..:::.||...|.|..:.    
Human   132 KFAFNLYR-VLKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQVHSILHFKDFVNASSKYEI 195

  Fly  1749 ---HLIFKNITNSVEQASDSDIATAAFVREIFSDRANGKILPFFKEKTQQLYAGHVEEVNFHVVN 1810
               |.:|:.:|:.:.:.:..  .|...|.:::..: ...||..||.|.::.|....:..:|.  :
Human   196 TTIHNLFRKLTHRLFRRNFG--YTLRSVNDLYIQK-QFPILLDFKTKVREYYFAEAQIADFS--D 255

  Fly  1811 DIVRRRTNLLVKRHTMGKVLEYLRT----------NSVWVNGPLATISANLFQTDCSHGSTTDRD 1865
            .....:||..:.:.|.|.:.:.|..          |.::..|..    .|.|..:.:|...    
Human   256 PAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSW----VNKFPVEMTHNHN---- 312

  Fly  1866 GEMFFQVHPTVRQRRLVPIPAVLYRSGFLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQSSISP 1930
                |:::    :|.:|.:..:..:..|||..:..||..::....| ..:|.:.|:| |:     
Human   313 ----FRLN----EREVVKVSMMQTKGNFLAANDQELDCDILQLEYV-GGISMLIVVP-HK----- 362

  Fly  1931 MDNLDRLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSFVNASLGLQKMGLRGLFKS 1995
            |..:..||..|.....   :.|::.:|:..    .||.||:|......|....|:.||:|.||..
Human   363 MSGMKTLEAQLTPRVV---ERWQKSMTNRT----REVLLPKFKLEKNYNLVESLKLMGIRMLFDK 420

  Fly  1996 DFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYPAPPLRKRNKDVDATDDDAFD 2060
            :          ||........|.|:.|...|...::|                :...||      
Human   421 N----------GNMAGISDQRIAIDLFKHQGTITVNE----------------EGTQAT------ 453

  Fly  2061 SSERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQARVPDAPRLRF--DKPFLYFVRHN 2123
                          :....||                      :|.:.::||  |:|||:.:..:
Human   454 --------------TVTTVGF----------------------MPLSTQVRFTVDRPFLFLIYEH 482

  Fly  2124 PTGMILFMGRF-NP 2136
            .|..:|||||. ||
Human   483 RTSCLLFMGRVANP 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 91/467 (19%)
SERPIND1NP_000176.2 HCII 62..497 CDD:239002 93/469 (20%)
Chemotactic activity 68..79
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 73..97
Glycosaminoglycan-binding site 192..212 3/19 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.