DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Serpinc1

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_001012027.1 Gene:Serpinc1 / 304917 RGDID:1307404 Length:465 Species:Rattus norvegicus


Alignment Length:471 Identity:92/471 - (19%)
Similarity:183/471 - (38%) Gaps:118/471 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1687 NELAFSYWRAITSEKISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEILKLD---DMVTFNP 1748
            :..|.::::.:...| :...::.:||.::::..:|..|||..:|..::.|:.|.|   :..:...
  Rat    89 SRFATNFYQHLADSK-NDNDNIFLSPLSISTAFAMTKLGACNNTLKQLMEVFKFDTISEKTSDQI 152

  Fly  1749 HLIFKNITNSVEQASD--SDIATAAFVREIFSDRANGKILPF---FKEKTQQLYAGHVEEVNFH- 1807
            |..|..:...:.:.::  |::.:|   ..:|.|    |.|.|   :::.::.:|...::.::|. 
  Rat   153 HFFFAKLNCRLYRKANKSSNLVSA---NRLFGD----KSLTFNESYQDVSEIVYGAKLQPLDFKE 210

  Fly  1808 -------VVNDIVRRRTNLLVK----RHTMGKVLEYLRTNSVWVNGPLATISANLFQTDCSHGST 1861
                   .:|:.|..:|...:|    :..:.::...:..|:::..|        |:::..|..:|
  Rat   211 NPEQSRVTINNWVANKTEGRIKDVIPQGAIDELTALVLVNTIYFKG--------LWKSKFSPENT 267

  Fly  1862 TDRDGEMFFQVHPTVRQRRLVPIPAVLYRSGFLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQS 1926
            ..   |.|   |....|..|||   ::|:.|............|:......:.::.|.::|    
  Rat   268 RK---EPF---HKVDGQSCLVP---MMYQEGKFKYRRVGEGTQVLEMPFKGDDITMVLILP---- 319

  Fly  1927 SISPMDNLDRLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSFVNASLGLQKMGLRG 1991
              .|..:|.::|:.|.....   |.|...|:.:|    :.|.:|||......:....||.|||..
  Rat   320 --KPEKSLAKVEQELTPELL---QEWLDELSEVM----LVVHVPRFRIEDSFSLKEQLQDMGLVD 375

  Fly  1992 LFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYPAPPLRKRNKDVDATDD 2056
            ||..:.:.|.|:...|..|:|:||                           ...|...:|:....
  Rat   376 LFSPEKSQLPGIIAEGRDDLFVSD---------------------------AFHKAFLEVNEEGS 413

  Fly  2057 DAFDSSERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQARVPDAPRLRFDKPFLYFVR 2121
            :|..|:..|:          .||.     |:|             :||    ..:.::|||..:|
  Rat   414 EAAASTSVVI----------TGRS-----LNP-------------SRV----TFKANRPFLVLIR 446

  Fly  2122 HNPTGMILFMGRF-NP 2136
            ......|:||||. ||
  Rat   447 EVALNTIIFMGRVSNP 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 90/469 (19%)
Serpinc1NP_001012027.1 antithrombin-III_like 80..459 CDD:239000 89/466 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.