DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and LOC299277

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:XP_008763124.2 Gene:LOC299277 / 299277 RGDID:1595900 Length:420 Species:Rattus norvegicus


Alignment Length:385 Identity:89/385 - (23%)
Similarity:167/385 - (43%) Gaps:62/385 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1649 TQSTRPPVKLDPSPESSQGLEASTAMMDEDLQSFARLCNELAFSYWRAITSEKISSARSLVISPF 1713
            |....|.|:.|  .::.:.|::.|         .|.:..:.|||.::.:..:  :..:::..||.
  Rat    25 TLGRHPEVQKD--QDTKKQLDSGT---------LASINTDFAFSLYKELALK--NPNKNIAFSPL 76

  Fly  1714 ALTSMLSMVFLGARGSTSGEMNEILK--LDDMVTFNPHLIFKNITNSVEQ-ASDSDIATAAFVRE 1775
            ::::.|:.:.|||:|:|..|:.|.||  |.:....:.|..::::...:.| .....|:.|..   
  Rat    77 SISAALASLSLGAKGNTLQEILEGLKFNLTETTEIDIHQNYRDLLQRLSQPGGQGQISRANL--- 138

  Fly  1776 IFSDRANGKILPFFKEKTQQLYAGHVEEVNFHVVNDIVRRRTNLLVKRHTMGKVLEYL-----RT 1835
            :|.:: :.:||..||||.:.||...|...:|....: .|:..|..|...:.||:.|.:     ||
  Rat   139 LFVEK-HLQILNGFKEKAKALYQTEVFATDFQQTCE-ARKFINDYVMIQSQGKIKEMVTELEERT 201

  Fly  1836 NSVWVNGPLATISANLFQTDCSHGS-TTDRDGEMFFQVHPTVRQRRLVPIPAVLYRSGFLAG--- 1896
            :.|.:|..|.|            |. :...|.:..|.....:..||  |:..::.::..|..   
  Rat   202 SIVMLNFLLFT------------GQWSVPFDPDDTFMGKFILDSRR--PVKVLMMKTEDLTTPYF 252

  Fly  1897 YEPSLDATVVSFGRVQNTVSTVYVMPGHQSSISPMDNLDRLERSLVETAFSDKQAWRRLLTSLMD 1961
            ::..|..|||.. ..:.....::::|       ....::::|.||      .....|:...||..
  Rat   253 WDEELKCTVVEL-NYKGHGKAMFILP-------DQGKMEQVEASL------HPGTLRKWTDSLKP 303

  Fly  1962 RPGMEVQLPRFSHRSFVNASLGLQKMGLRGLFKSDFADLRGLTGAGNRDIFLSDMIQINT 2021
            |...|:.||:||..........|.::|:..:|.:. |||.|:.||  :|:.:|.||. ||
  Rat   304 RIIDELHLPKFSLSKTYKLENILPELGIMDVFNTQ-ADLSGIAGA--KDVRVSQMIH-NT 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 82/347 (24%)
LOC299277XP_008763124.2 serpinA3_A1AC 37..417 CDD:381019 85/371 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.