DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Serpina16

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_853661.2 Gene:Serpina16 / 299271 RGDID:727888 Length:415 Species:Rattus norvegicus


Alignment Length:551 Identity:95/551 - (17%)
Similarity:176/551 - (31%) Gaps:211/551 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1640 LLINLMASSTQSTRPPVKLDPSPESSQGLEASTAMMDEDLQSFARLCNELAFSYWRAITSEKISS 1704
            ||..|:..|.....|     |.||:|   ..|...:.:....|.. ..:.|.|.::.:...|  .
  Rat    11 LLAGLVPCSCDPQTP-----PPPEAS---NMSQIPVTQGAPPFFN-NQKFALSLYKQLPQPK--R 64

  Fly  1705 ARSLVISPFALTSMLSMVFLGARGSTSGEMNEILKLDDMVTFNPHLIFKNITNSVEQASDSDIAT 1769
            .::|:.||..:  ::.:|.|..:......               |.:.:::..:|..|.|:..|:
  Rat    65 GKNLIFSPLGI--IVPLVLLAFQDKPKAR---------------HQVLQDLGFTVTGALDTKAAS 112

  Fly  1770 AAFVREIFSDRANGKILP---------------FFKEKTQQLYAGHVEEVNFHVVNDIV------ 1813
                       ..||:|.               .|.:||.:.....|:..|....:::|      
  Rat   113 -----------EYGKLLSNLLHTKNCGIYTGSLLFIDKTLKPAKTFVKLANSSYNSNVVLISFGN 166

  Fly  1814 ----RRRTNLLVKRHTMGKVLEYLR-----TNSVWVNGPLATISANLFQTDCSHGSTTDRDGEMF 1869
                :::.:|.::..|.||:.:.||     ||       |...:.|.|:....:         .|
  Rat   167 YGLAQKQIDLAIRARTHGKITKLLRILKPPTN-------LFLANYNFFKGKWKY---------PF 215

  Fly  1870 FQVHPTVR-------QRRLVPIPAVLYRSG-FLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQS 1926
            .:.|..:|       .:.|||   ::.|.| |...|...:.:.|:.. ....::|.|:.:|..  
  Rat   216 NRKHTRMRYFWLEDGTKTLVP---MMQRVGWFQLQYFSQMHSYVLQL-PFTCSISGVFFLPDD-- 274

  Fly  1927 SISPMDNLDRLERSLVETAFSDKQAW-------RRLLTSLMDRPGMEVQLPRFS--------HRS 1976
                 ...:..|::|:|.:|   :.|       :|.|.           .|:||        :..
  Rat   275 -----GKFEESEKALLEQSF---ETWIQPFPMSKRWLF-----------FPKFSIPVALHLENLK 320

  Fly  1977 FVNASLGLQKMGLRGLFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYPA 2041
            .||:::.|         .|:..||..:| .....:.:|..:                |.||:   
  Rat   321 HVNSNIKL---------FSEHMDLSRIT-LQKAPLTVSTAV----------------HRVEL--- 356

  Fly  2042 PPLRKRNKDVDATDDDAFDSSERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQARVPD 2106
                ..|:|.:..|:.                                        :|.    ||
  Rat   357 ----TVNEDGEEKDES----------------------------------------QPE----PD 373

  Fly  2107 APRLRFDKPFLYFVRHNPTGMILFMGR-FNP 2136
            ...|.|::.||..:....:..:||||: .||
  Rat   374 LATLHFNRSFLLLILDETSNSLLFMGKVVNP 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 82/502 (16%)
Serpina16NP_853661.2 serpinA16_HongrES1-like 40..406 CDD:381053 85/514 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.