DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Serpinf1

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_808788.1 Gene:Serpinf1 / 287526 RGDID:631369 Length:418 Species:Rattus norvegicus


Alignment Length:506 Identity:108/506 - (21%)
Similarity:193/506 - (38%) Gaps:132/506 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1648 STQSTRPPVKLDPSPESSQGLEASTAMMDEDLQSFARLCNELA-----FSY--WRAITSEKISSA 1705
            |:|:.....:..|:|:|:     ...:::||...|....|:||     |.|  :| :.|..:|:.
  Rat    18 SSQNVPDSSQDSPAPDST-----GEPVVEEDDPFFKAPVNKLAAAVSNFGYDLYR-LRSGAVSTG 76

  Fly  1706 RSLVISPFALTSMLSMVFLGARGSTSGEMNEILKLDDMVTFNP--HLIFKNITNSVEQASDSDIA 1768
             ::::||.::.:.||.:.|||...|...::..|..|  :..||  |..:|.:..|| .|.:.:..
  Rat    77 -NILLSPLSVATALSALSLGAEQRTESVIHRALYYD--LINNPDIHSTYKELLASV-TAPEKNFK 137

  Fly  1769 TAAFVREIFSDRANGK---ILPFFKE--KTQQLYAGHVEEVNFHVVNDIVRRRTNLLVKRHT--M 1826
            :|:  |.:|..:...|   :.|..|.  ...::..|: ..::...:|:.|:.:....:.|.|  |
  Rat   138 SAS--RIVFERKLRVKSSFVAPLEKSYGTRPRILTGN-PRIDLQEINNWVQAQMKGKIARSTREM 199

  Fly  1827 GKVLEYLRTNSVWVNGPLATISANLFQTDCSHGSTTDRDGEMFFQVHPTVRQRRLVPI---PAVL 1888
            ...|..|.....:..|..|        |......||.:|  .......|||    ||:   |..:
  Rat   200 PSALSILLLGVAYFKGQWA--------TKFDSRKTTLQD--FHLDEDRTVR----VPMMSDPKAI 250

  Fly  1889 YRSGFLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQSSISPMDNLDRLERSLVETAFSDKQAWR 1953
            .|.|.    :..|:..:... .:..::|.::.:|     ::...||..:|.||......|.....
  Rat   251 LRYGL----DSDLNCKIAQL-PLTGSMSIIFFLP-----LTVTQNLTMIEESLTSEFVHDIDREL 305

  Fly  1954 RLLTSLMDRPGMEVQLPRFSHRSFVNASLGLQKMGLRGLFKS-DFADLRGLTGAGNRDIFLSDMI 2017
            :.:.:::..|.:     :.|:...|..|  ||.|.|:.||:| ||:.:.|      :.:.|:.: 
  Rat   306 KTIQAVLTVPKL-----KLSYEGDVTNS--LQDMKLQSLFESPDFSKITG------KPVKLTQV- 356

  Fly  2018 QINTFSTCGEEKISEHHHVEMYPAPPLRKRNKDVDATDDDAFDSSERVVDFGSLVQESALGRGFY 2082
                          ||.                      .||:.:|          |.| |....
  Rat   357 --------------EHR----------------------AAFEWNE----------EGA-GTSSN 374

  Fly  2083 DDLLDPKYLELPLPLRPRQARVPDAPRLRFDKPFLYFVRHNPTGMILFMGR 2133
            .| |.|..|..||.             ...::||::.:|...||.:||:||
  Rat   375 PD-LQPVRLTFPLD-------------YHLNRPFIFVLRDTDTGALLFIGR 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 100/467 (21%)
Serpinf1NP_808788.1 PEDF 40..415 CDD:239007 103/479 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.