DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Serpina3n

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_113719.3 Gene:Serpina3n / 24795 RGDID:3747 Length:418 Species:Rattus norvegicus


Alignment Length:489 Identity:106/489 - (21%)
Similarity:194/489 - (39%) Gaps:142/489 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1678 DLQSFARLCNELAFSYWRAITSEKISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEILKLDD 1742
            |..:.|.:..:.|||.::.:...  :..:::|.||.::::.|::|.|||:|::..|:.|.||.: 
  Rat    43 DSLTLASINTDFAFSLYKKLALR--NPDKNVVFSPLSISAALAVVSLGAKGNSMEEILEGLKFN- 104

  Fly  1743 MVTFNP----HLIFKNITNSVEQASDS-DIAT--AAFVREIFSDRANGKILPFFKEKTQQLYAGH 1800
             :|..|    |..|.::...:.|..|. .|:|  |.|:.:..      ::|..|:||.:.||...
  Rat   105 -LTETPETEIHRGFGHLLQRLSQPRDEIQISTGNALFIEKRL------QVLAEFQEKAKALYQAE 162

  Fly  1801 VEEVNFHVVNDIVRRRTNLLVKRHTMGKVLEYL-----RTNSVWVN------------GPLATIS 1848
            ....:|....: .::..|..|.:.|.||:...:     :|:.|.||            .|..|  
  Rat   163 AFTADFQQSRE-AKKLINDYVSKQTQGKIQGLITNLAKKTSMVLVNYIYFKGKWKVPFDPRDT-- 224

  Fly  1849 ANLFQTDCSHGSTTDRDGEMFFQVHPTVRQRRLVPIPAVLYRSGFLAGY--EPSLDATVVSFGRV 1911
               ||::...|                  :||.|.:| ::........|  :..|:.|||.. :.
  Rat   225 ---FQSEFYSG------------------KRRPVKVP-MMKLEDLTTPYVRDEELNCTVVEL-KY 266

  Fly  1912 QNTVSTVYVMPGHQSSISPMDNLDRLERSLVETAFSDKQAWRRLLTSLMDRPGM--EVQLPRFSH 1974
            ....|.::::|       ....:.::|.||      ..:..||...||  ||.|  |:.||:||.
  Rat   267 TGNASALFILP-------DQGKMQQVEASL------QPETLRRWKDSL--RPSMIDELYLPKFSI 316

  Fly  1975 RSFVNASLGLQKMGLRGLFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMY 2039
            .:..|....|.::|::.:|.:. |||.|:|  |::|:.:|.::.                     
  Rat   317 SADYNLEDVLPELGIKEVFSTQ-ADLSGIT--GDKDLMVSQVVH--------------------- 357

  Fly  2040 PAPPLRKRNKDVDATDDDAFDSSERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQARV 2104
                                   :.|:|......|:|...|.       |::       |..|::
  Rat   358 -----------------------KAVLDVAETGTEAAAATGV-------KFV-------PMSAKL 385

  Fly  2105 PDAPRLRFDKPFLYFVRHNPTGMILFMGR-FNPR 2137
             |...:.||:|||..:....|.:..|:.: |||:
  Rat   386 -DPLIIAFDRPFLMIISDTETAIAPFLAKIFNPK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 102/477 (21%)
Serpina3nNP_113719.3 serpinA3_A1AC 37..418 CDD:381019 105/487 (22%)
RCL 367..394 8/41 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.