DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Serpina1

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_071964.2 Gene:Serpina1 / 24648 RGDID:3326 Length:411 Species:Rattus norvegicus


Alignment Length:509 Identity:103/509 - (20%)
Similarity:195/509 - (38%) Gaps:154/509 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1658 LDPSPESSQGLEASTAMMDEDLQSFARLCNEL---AFSYWRAITSEKISSARSLVISPFALTSML 1719
            |.||..:....|..|:..|:. .::.::.:.|   |||.:|.:..:  |:..::..||.::|:..
  Rat    18 LAPSFLAEDAQETDTSQQDQS-PTYRKISSNLADFAFSLYRELVHQ--SNTSNIFFSPMSITTAF 79

  Fly  1720 SMVFLGARGSTSGEMNEILK--LDDMVTFNPHLIFKNITNSVEQASDSDI----ATAAFVREIFS 1778
            :|:.||::|.|..::.|.|:  |..:...:.|..|.::..::.: .||::    ....||.:   
  Rat    80 AMLSLGSKGDTRKQILEGLEFNLTQIPEADIHKAFHHLLQTLNR-PDSELQLNTGNGLFVNK--- 140

  Fly  1779 DRANGKILPFFKEKTQQLYAGHVEEVNF-------HVVNDIVRRRTNLLVKRHTMGKVLEYLR-- 1834
               |.|::..|.|:.:..|......|||       .|:||        .|::.|.||:::.::  
  Rat   141 ---NLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVIND--------YVEKGTQGKIVDLMKQL 194

  Fly  1835 --------TNSVWVNG-------PLATISANLFQTDCSHGSTTDRDGEMFFQVHPTVRQRRLVPI 1884
                    .|.::..|       |..|..|: |..|   .|||                   |.:
  Rat   195 DEDTVFALVNYIFFKGKWKRPFNPEHTRDAD-FHVD---KSTT-------------------VKV 236

  Fly  1885 PAVLYRSGFLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQSSISPMDNLDRLERSLVETAFSDK 1949
            |.:.....|...|..:|.:.|:....:.| .:.::::|..       ..:..||::|.:...|  
  Rat   237 PMMNRLGMFDMHYCSTLSSWVLMMDYLGN-ATAIFLLPDD-------GKMQHLEQTLTKDLIS-- 291

  Fly  1950 QAWRRLLTSLMDRPGMEVQLPRFSHRSFVNASLGLQKMGLRGLFKSDFADLRGLTGAGNRDIFLS 2014
                |.|.:...|..: :..|:.|.....|....|..:|:..:|.:| |||.|:|    .|..| 
  Rat   292 ----RFLLNRQTRSAI-LYFPKLSISGTYNLKTLLSSLGITRVFNND-ADLSGIT----EDAPL- 345

  Fly  2015 DMIQINTFSTCGEEKISEHHHVEMYPAPPLRKRNKDVDATDDDAFDSSERVVDFGSLVQESALGR 2079
                          |:|:..|             |.|...|:...:::      |:.|.|:    
  Rat   346 --------------KLSQAVH-------------KAVLTLDERGTEAA------GATVVEA---- 373

  Fly  2080 GFYDDLLDPKYLELPLPLRPRQARVPDAPRLRFDKPFLYFVRHNPTGMILFMGR 2133
                         :|:.|         .|:::||.||::.:..:.|...||:|:
  Rat   374 -------------VPMSL---------PPQVKFDHPFIFMIVESETQSPLFVGK 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 97/480 (20%)
Serpina1NP_071964.2 alpha-1-antitrypsin_like 49..406 CDD:239011 96/477 (20%)
RCL 367..386 7/44 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.