DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Serpine1

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_036752.2 Gene:Serpine1 / 24617 RGDID:3249 Length:402 Species:Rattus norvegicus


Alignment Length:475 Identity:108/475 - (22%)
Similarity:176/475 - (37%) Gaps:170/475 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1703 SSARSLVISPFALTSMLSMVFLGARGSTSGEMNEILKLDDMVTFN-------PHL--IFKNITNS 1758
            |..|::|.||:.::|:|:|:.|...|.|..:      :.|.:.||       |.|  :.|.:..|
  Rat    50 SKDRNVVFSPYGVSSVLAMLQLTTAGKTRQQ------IQDAMGFNISERGTAPALRKLSKELMGS 108

  Fly  1759 VEQASDSDIATAAFV-REIFSDRANGKILPFFKEKTQQLYAGHVEEVNF-------HVVNDIVRR 1815
            ..: ::...|.|.|| |::  :...|.:..|||     |:...|::|:|       .::||.|.|
  Rat   109 WNK-NEISTADAIFVQRDL--ELVQGFMPHFFK-----LFRTTVKQVDFSEMERARFIINDWVER 165

  Fly  1816 RT-----NLLVKRHTMGKVLEYLR---TNSVWVNG----PL--ATISANLFQTDCSHGSTTDRDG 1866
            .|     :||.|    |.|.|..|   .|:::.||    |.  |:....||..  |.|||     
  Rat   166 HTKGMISDLLAK----GAVNELTRLVLVNALYFNGQWKTPFLEASTHQRLFHK--SDGST----- 219

  Fly  1867 EMFFQVHPTVRQRRLVPIPAVLYRSGFLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQSSIS-- 1929
                           :.:|.:...:.|          ....|.........:..:|.|..::|  
  Rat   220 ---------------ISVPMMAQNNKF----------NYTEFTTPDGHEYDILELPYHGETLSMF 259

  Fly  1930 ---------PMDNLDR-LERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSFVNASLGL 1984
                     |:..:.. |:..|:       :.|:..:|.|   |.:.: ||:||..:.|:....|
  Rat   260 IAAPFEKDVPLSAITNILDAELI-------RQWKSNMTRL---PRLLI-LPKFSLETEVDLRGPL 313

  Fly  1985 QKMGLRGLFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYPAPPLRKRNK 2049
            :|:|:..:|.|..||...          |||..|::.                   |..|:|...
  Rat   314 EKLGMTDIFSSTQADFTS----------LSDQEQLSV-------------------AQALQKVKI 349

  Fly  2050 DVDATDDDAFDSSERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQARVPDAP-RLRFD 2113
            :|:.:...|..|:..:|                                  .||:  || .:..|
  Rat   350 EVNESGTVASSSTAILV----------------------------------SARM--APTEMVLD 378

  Fly  2114 KPFLYFVRHNPTGMILFMGR 2133
            :.||:.||||||..|||||:
  Rat   379 RSFLFVVRHNPTETILFMGQ 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 108/475 (23%)
Serpine1NP_036752.2 serpin 29..402 CDD:422956 108/475 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.