DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Serpina3f

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_001028507.2 Gene:Serpina3f / 238393 MGIID:2182838 Length:445 Species:Mus musculus


Alignment Length:511 Identity:109/511 - (21%)
Similarity:193/511 - (37%) Gaps:150/511 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1662 PESSQGLEASTAMMDEDLQSFARLC-----NELAFSYWRAITSEKISSARSLVISPFALTSMLSM 1721
            |:.:.|...:...:.|::.|...|.     .:.|||.::.:..:  :...::|.|||::.:.|::
Mouse    12 PDVTLGRNTAVREVQENITSVDSLTLASSNTDFAFSLYKELVLK--NPDENVVFSPFSICTALAL 74

  Fly  1722 VFLGARGSTSGEMNEILKLDDMVTFNP--HLIFKNITNSVEQASDS-DIAT--AAFVREIFSDRA 1781
            :.|||:.:|..|:.|.||.:...|..|  |..|:.:.:.:.|..:. .|:|  |.|:.:      
Mouse    75 LSLGAKSNTLKEILEGLKFNLTETPEPDIHQGFRYLLDLLSQPGNQVQISTGSALFIEK------ 133

  Fly  1782 NGKILPFFKEKTQQLYAGHVEEVNFH-------VVNDIVRRRTNLLVKRHTMGKVLEYL-----R 1834
            :.:||..||||.:.||.......:|.       ::||        .|..||.||:.|.:     |
Mouse   134 HLQILAEFKEKARALYQAEAFTADFQQPLEATKLIND--------YVSNHTQGKIKELISDLDKR 190

  Fly  1835 T-----NSVWVNGPLATISANLFQTDCSHGSTTDRDGEMFFQVHPTVR------QRRLVPIPAVL 1888
            |     |.::..|                      ..||.|....|.:      :.|.|.:| ::
Mouse   191 TLMVLVNYIYFKG----------------------KWEMPFDPDDTCKSEFYLDENRSVKVP-MM 232

  Fly  1889 YRSGFLAGY--EPSLDATVVSFGRVQNTVSTVYVMPGHQSSISPMDNLDRLERSLVETAFSDKQA 1951
            ..:.....|  :..|..|||.. :.....|.::::|       ....:.::|.||      ..:.
Mouse   233 KINNLTTPYFRDEELSCTVVEL-KYTGNASAMFILP-------DQGKMQQVEASL------QPET 283

  Fly  1952 WRRLLTSLMDRPGMEVQLPRFSHRSFVNASLGLQKMGLRGLFKSDFADLRGLTGAGNRDIFLSDM 2016
            .|....||..|...|:.||:||..:..:....|.::|:|.||.:. |||..:|  |.:|:..|.:
Mouse   284 LRNWKDSLKPRLINELCLPKFSISTDYSLEHILPELGIRELFSTQ-ADLSAIT--GTKDLRTSQV 345

  Fly  2017 IQINTFSTCGEEKISEHHHVEMYPAPPLRKRNKDVDATDDDAFDSSERVVDFGSLVQESALGRGF 2081
            :.                                            :.|:|......|:|.|.|:
Mouse   346 VH--------------------------------------------KAVLDVAETGTEAAAGTGY 366

  Fly  2082 YDDLLDPKYLELPLPLRPRQARVPDAPRLRFDKPFLYFVRHNPTGMILFMGRF-NP 2136
            .:             |:..|. |..:.::.||:|||..:....|.:.|||.:. ||
Mouse   367 QN-------------LQCCQG-VIYSMKIYFDRPFLMIISDTNTHIALFMAKVSNP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 102/479 (21%)
Serpina3fNP_001028507.2 alpha-1-antitrypsin_like 40..405 CDD:239011 102/478 (21%)
RCL 357..382 7/38 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.