DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Serpina3m

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_033279.2 Gene:Serpina3m / 20717 MGIID:98378 Length:418 Species:Mus musculus


Alignment Length:484 Identity:101/484 - (20%)
Similarity:190/484 - (39%) Gaps:130/484 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1677 EDLQSFARLCNELAFSYWRAITSEKISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEILK-- 1739
            :|..:.|.:..:.|||.::.:..:  :..:::|.||.::::.|::|.|||:|:|..|:.|.||  
Mouse    42 DDSLTLASINTDFAFSLYKKMALK--NPDKNIVFSPLSISAALALVSLGAKGNTLEEILEGLKFN 104

  Fly  1740 LDDMVTFNPHLIFKNITNSVEQASDSD---IATAAFVREIFSDRANGKILPFFKEKTQQLYAGHV 1801
            |.:....:.|..|.::...:.|..|.|   |..|.|:.:      :.:||..|.|||:.||....
Mouse   105 LTETSEADIHQGFGHLLQRLSQPEDQDQINIGNAMFIEK------DLQILAEFHEKTRALYQTEA 163

  Fly  1802 EEVNFH-------VVNDIVRRRTNLLVKR-------HTMGKVLEYLRTNSVWVNGPLATISANLF 1852
            ...:|.       ::||.|..:|..::|:       .|:..::.|:.....|      .||.   
Mouse   164 FTADFQQPTEATKLINDYVSNQTQGMIKKLISELDDRTLMVLVNYIYFKGKW------KISF--- 219

  Fly  1853 QTDCSHGSTTDRDGEMFFQVHPTVRQRRLVPIPAVLYRSGFLAG---YEPSLDATVVSFGRVQNT 1914
                        |.:..|:....:.::|.|.:|  :.:..||..   .:..|..:|:.. :....
Mouse   220 ------------DPQDTFESEFYLDEKRSVKVP--MMKMKFLTTRHFRDEELSCSVLEL-KYTGN 269

  Fly  1915 VSTVYVMPGHQSSISPMDNLDRLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSFVN 1979
            .|.::::|       ....:.::|.||      ..:..|:...||..|...|:.||:||..:..|
Mouse   270 ASALFILP-------DQGRMQQVEASL------QPETLRKWWKSLKTRKIGELYLPKFSISTDYN 321

  Fly  1980 ASLGLQKMGLRGLFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYPAPPL 2044
            ....|.::|::.:| |..|||.|:|  |.:|:.:|.::.                          
Mouse   322 LKDILPELGIKEIF-SKQADLSGIT--GTKDLSVSQVVH-------------------------- 357

  Fly  2045 RKRNKDVDATDDDAFDSSERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQARVPDAPR 2109
                              :.|:|......|:|...||.            ...|.|:.:   ...
Mouse   358 ------------------KAVLDVAETGTEAAAATGFI------------FGFRSRRLQ---TMT 389

  Fly  2110 LRFDKPFLYFVRHNPTGMILFMGRF-NPR 2137
            ::|::|||..:.|......|||.:. ||:
Mouse   390 VQFNRPFLMVISHTGVQTTLFMAKVTNPK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 97/471 (21%)
Serpina3mNP_033279.2 SERPIN 56..417 CDD:214513 96/467 (21%)
RCL 367..392 6/39 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.