DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Serpina1e

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_033273.1 Gene:Serpina1e / 20704 MGIID:891967 Length:413 Species:Mus musculus


Alignment Length:518 Identity:105/518 - (20%)
Similarity:193/518 - (37%) Gaps:153/518 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1640 LLINLMASSTQSTRPPVKLDPSPESSQGLEASTAMMDEDLQSFARLCNELAFSYWRAITSEKISS 1704
            |:.:.:|...|.|....| |.||.|.   |.:|.:.|            .|.|.:|.:..:  |:
Mouse    18 LVPSFLAEDVQETDTSQK-DQSPASH---EIATNLGD------------FAISLYRELVHQ--SN 64

  Fly  1705 ARSLVISPFALTSMLSMVFLGARGSTSGEMNEILKLDDMVTFNP--HLIFKNITNSVEQASDSDI 1767
            ..::..||.::.:..:|:.||::|.|..::.|.|:.:...|...  |..|:::..::.: .||::
Mouse    65 TSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHNSFQHLLQTLNR-PDSEL 128

  Fly  1768 ATAAFVREIFSDRANG-------KILPFFKEKTQQLYAGHVEEVNF-------HVVNDIVRRRTN 1818
            ..:.         .||       |::..|.|:.:..|...|..|||       .|:||       
Mouse   129 QLST---------GNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVIND------- 177

  Fly  1819 LLVKRHTMGKVLE---YLRTNSVWVNGPLATISANLFQTDCSHGSTTDRDGEMFFQVHPTVRQRR 1880
             .|::.|.||::|   .|..::|:|       .||............|.:.....:.|  |.:..
Mouse   178 -FVEKGTQGKIVEAVKKLEQDTVFV-------LANYILFKGKWKKPFDPENTKQAEFH--VDEST 232

  Fly  1881 LVPIPAVLYRSGFLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQSSISPMDNLDR-LERSLVET 1944
            .|.:| ::..||.|..:..|..::.|.........:.|:::|..    ..|.:|:: |.:.|:..
Mouse   233 TVKVP-MMTLSGMLDVHHCSTLSSWVLLMDYAGNATAVFLLPDD----GKMQHLEQTLNKELISK 292

  Fly  1945 AFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSFVNASLGLQKMGLRGLFKSDFADLRGLTGAGNR 2009
            ...:::  |||         .::.:||.|.....|....:..:|:..:|.|. |||.|:|     
Mouse   293 FLLNRR--RRL---------AQIHIPRLSISGNYNLETLMSPLGITRIFNSG-ADLSGIT----- 340

  Fly  2010 DIFLSDMIQINTFSTCGEE----KISEHHHVEMYPAPPLRKRNKDVDATDDDAFDSSERVVDFGS 2070
                             ||    |:|:..|          |....:|.|..:|..::        
Mouse   341 -----------------EENAPLKLSQAVH----------KAVLTIDETGTEAAAAT-------- 370

  Fly  2071 LVQESALGRGFYDDLLDPKYLELPLPLRPRQARVPDAPRLRFDKPFLYFVRHNPTGMILFMGR 2133
                          :|...:|.:|             |.|.|::|||:.:....:...||:|:
Mouse   371 --------------VLQGGFLSMP-------------PILHFNRPFLFIIFEEHSQSPLFVGK 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 93/471 (20%)
Serpina1eNP_033273.1 SERPIN 53..410 CDD:214513 92/467 (20%)
RCL 368..387 6/53 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.