DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Serpina12

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_620180.2 Gene:Serpina12 / 191570 RGDID:708485 Length:414 Species:Rattus norvegicus


Alignment Length:477 Identity:95/477 - (19%)
Similarity:179/477 - (37%) Gaps:125/477 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1677 EDLQSFARLCNELAFSYWRAITSEKISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEILKLD 1741
            :|.:...|...|..|...:.:.|.  |...::.:||.::::..||:.|||:.||..|:.|.....
  Rat    43 KDARELTRHNMEFGFKLLQRLASN--SRQGNIFLSPLSISTAFSMLSLGAQNSTLEEIREGFNFK 105

  Fly  1742 DMVTFNPHLIFKNITNSVEQASDS---DIATAAFVREIFSDRANGKILPFFKEKTQQLYAGHVEE 1803
            :|...:.|:.|..:...:.:.:..   .|..|.|:.:....:..      |.:..:.||...:..
  Rat   106 EMSDRDMHMGFHYLLQKLNRETQDVKMSIGNALFMDQRLRPQQR------FLKLAKNLYDADMIL 164

  Fly  1804 VNFH-------VVNDIVRRRTN----LLVKRHTMGKVLEYLRTNSVWVNGPLATISANLFQTDCS 1857
            .||.       .:|..:.|:|:    .:||....|.|:  |.||.::..|        .:|.:..
  Rat   165 TNFQDLENTQKNINKYISRKTHNRIENMVKNIDPGTVM--LLTNYIYFQG--------RWQYEFD 219

  Fly  1858 HGSTTDRDGEMFFQVHPTVRQRRLVPIPAVLYRSGFLAGYEPSLDATVVSFGRVQNTVSTVYVMP 1922
            ...|.:.|   ||     :.:.:.|.:|.:..|..:...|:..|..|::.....:|..:| :|:|
  Rat   220 PKQTKEED---FF-----IEEGKTVKVPMMFQRGMYDMAYDSQLSCTILEMPYRRNITAT-FVLP 275

  Fly  1923 GHQSSISPMDNLDRLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSFVNASLGLQKM 1987
                   ....|..||:.|....|:   .|:    ||:.:..::|.:||....:..|....|.::
  Rat   276 -------DSGKLRLLEQGLQADIFA---KWK----SLLSKRVVDVWVPRLHISATYNMKKVLSRL 326

  Fly  1988 GLRGLFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYPAPPLRKRNKDVD 2052
            |:..:|: :..||                           .:||.|..:::              
  Rat   327 GISKIFE-EHGDL---------------------------TRISSHRSLKV-------------- 349

  Fly  2053 ATDDDAFDSSE-RVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLR-PRQARVPDAPRLRFDKP 2115
               .:|...:| |:.:.|:   |.|.|.|           ...||:. ||        |::.:.|
  Rat   350 ---GEAVHKAELRMNEKGT---EGAAGSG-----------AQTLPMETPR--------RMKLNAP 389

  Fly  2116 FLYFVRHNPTGMILFMGR-FNP 2136
            ||..:..|....::|:.| :||
  Rat   390 FLMMIYENLMPSMIFLARIYNP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 91/465 (20%)
Serpina12NP_620180.2 alpha-1-antitrypsin_like 51..408 CDD:239011 90/464 (19%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.