DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Serpina6

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_031644.1 Gene:Serpina6 / 12401 MGIID:88278 Length:397 Species:Mus musculus


Alignment Length:374 Identity:80/374 - (21%)
Similarity:147/374 - (39%) Gaps:100/374 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1665 SQGLEASTAMMDEDLQSFARLCN---ELAFSYWRAITSEKISSARSLVISPFALTSMLSMVFLGA 1726
            :.||..:.|:.|||..|...|..   :.||:.::.:.:  ::|.::.:|||.:::..|:|:.|..
Mouse    14 TSGLWTTQAVTDEDSSSHRDLAPTNVDFAFNLYKRLVA--LNSDKNTLISPVSISMALAMLSLST 76

  Fly  1727 RGSTSGEMNEILKLDDMVTFNPHLIFKNITNSVEQASDS----DIATAAFVREIFSDRANGKILP 1787
            ||||....|....:..|.....|..|:.: ||:.|.||:    ::....|:.:      |.|:..
Mouse    77 RGSTQYLENLGFNMSKMSEAEIHQGFQYL-NSLLQQSDTGLEMNMGNVMFLLQ------NLKLKD 134

  Fly  1788 FFKEKTQQLYAGHV------------EEVNFHVVNDIVRRRTNLLVKRHTMGKV----------- 1829
            .|...|:..|....            |::|.|             ||..|.||:           
Mouse   135 SFLADTKHYYESEALTIPSKDWTKAGEQINNH-------------VKNKTQGKIEHVVSDLDSSA 186

  Fly  1830 ----LEYLRTNSVWVNGPLATISANLFQTDCSHGSTTDRDGEMFFQVHPTVRQRRLVPIPAVLYR 1890
                :.|:....:|             :...|..:|.:.|   |:     |.:...|.:| ::.:
Mouse   187 TLILINYIFLKGIW-------------KLPFSPENTREED---FY-----VNETSTVKVP-MMVQ 229

  Fly  1891 SGFLAGYEPS-LDATVVSFGRVQNTVSTVYVMP--GHQSSISPMDNLDRLERSLVETAFSDKQAW 1952
            ||.::.:..| :...:|....|.|. :|..::|  |...::....|.|.::|            |
Mouse   230 SGNISYFRDSAIPCQMVQMNYVGNG-TTFIILPDQGQMDTVVAALNRDTIDR------------W 281

  Fly  1953 RRLLTSLMDRPGMEVQLPRFSHRSFVNASLGLQKMGLRGLF--KSDFAD 1999
            .:|:....    |.:.:|:||.....:....|..:|::.||  :|||||
Mouse   282 GKLMIPRQ----MNLYIPKFSMSDTYDLQDVLADVGIKDLFTNQSDFAD 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 72/352 (20%)
Serpina6NP_031644.1 SERPIN 43..396 CDD:214513 71/345 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.