DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Serpinc1

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_543120.1 Gene:Serpinc1 / 11905 MGIID:88095 Length:465 Species:Mus musculus


Alignment Length:465 Identity:89/465 - (19%)
Similarity:178/465 - (38%) Gaps:106/465 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1687 NELAFSYWRAITSEKISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEILKLD---DMVTFNP 1748
            :..|.::::.:...| :...::.:||.::::..:|..|||...|..::.|:.|.|   :..:...
Mouse    89 SRFATNFYQHLADSK-NDNDNIFLSPLSISTAFAMTKLGACNDTLKQLMEVFKFDTISEKTSDQI 152

  Fly  1749 HLIFKNITNSVEQASD--SDIATAAFVREIFSDRANGKILPF---FKEKTQQLYAGHVEEVNFHV 1808
            |..|..:...:.:.::  ||:.:|   ..:|.|    |.|.|   :::.::.:|...::.::|..
Mouse   153 HFFFAKLNCRLYRKANKSSDLVSA---NRLFGD----KSLTFNESYQDVSEVVYGAKLQPLDFKE 210

  Fly  1809 VNDIVRRRTNLLVKRHTMGKVLEYLRTNSVWVNGPLATISAN------LFQTDCSHGSTTDRDGE 1867
            ..:..|...|..|...|.|::.:.:...:  :|...|.:..|      |:::..|..:|..   |
Mouse   211 NPEQSRVTINNWVANKTEGRIKDVIPQGA--INELTALVLVNTIYFKGLWKSKFSPENTRK---E 270

  Fly  1868 MFFQVHPTVRQRRLVPIPAVLYRSGFLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQSSISPMD 1932
            .|::|     ..:..|:| ::|:.|.......:....|:......:.::.|.::|      .|..
Mouse   271 PFYKV-----DGQSCPVP-MMYQEGKFKYRRVAEGTQVLELPFKGDDITMVLILP------KPEK 323

  Fly  1933 NLDRLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSFVNASLGLQKMGLRGLFKSDF 1997
            :|.::|:.|.....   |.|...|:..|    :.|.:|||......:....||.|||..||..:.
Mouse   324 SLAKVEQELTPELL---QEWLDELSETM----LVVHMPRFRTEDGFSLKEQLQDMGLIDLFSPEK 381

  Fly  1998 ADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYPAPPLRKRNKDVDATDDDAFDSS 2062
            :.|.|:...|..|:::||                           ...|...:|:....:|..|:
Mouse   382 SQLPGIVAGGRDDLYVSD---------------------------AFHKAFLEVNEEGSEAAAST 419

  Fly  2063 ERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQARVPDAPRLRFDKPFLYFVRHNPTGM 2127
            ..|:...||                                .|:....:.::|||..:|......
Mouse   420 SVVITGRSL--------------------------------NPNRVTFKANRPFLVLIREVALNT 452

  Fly  2128 ILFMGRF-NP 2136
            |:||||. ||
Mouse   453 IIFMGRVANP 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 87/463 (19%)
Serpinc1NP_543120.1 serpinC1_AT3 71..464 CDD:381002 89/465 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.