DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and Serpini1

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:NP_446231.1 Gene:Serpini1 / 116459 RGDID:619896 Length:410 Species:Rattus norvegicus


Alignment Length:492 Identity:102/492 - (20%)
Similarity:179/492 - (36%) Gaps:135/492 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1666 QGLEASTAMMDEDLQSFARLCNELAFSYWRAITSEKISSARSLVISPFALTSMLSMVFLGARGST 1730
            |.|....|..||.:..::  .|  .:::.||...::     :::.||.::...:.::.|||:|||
  Rat    13 QSLVTGAAFPDETIAEWS--VN--VYNHLRATGEDE-----NILFSPLSIALAMGVMELGAQGST 68

  Fly  1731 SGEMN-----EILKLDDMVTFNPHLIFKNITNSVEQASDSDIATAAFVREIFSDRANGKILPFFK 1790
            ..|:.     |.||..:..:|...  |.::.::.|......||.:.||:..|  ..|.:.|...|
  Rat    69 LKEIRHSMGYESLKSGEEFSFLRD--FSSMVSAEEGQYVMKIANSLFVQNGF--HINEEFLQMMK 129

  Fly  1791 EKTQQLYAGHVEEVNF-------HVVNDIVRRRTNLLVK----RHTMGKVLEYLRTNSVWVNGPL 1844
                ..:...|..|:|       :.:|..|...||.|:|    ......|......|:|:..|..
  Rat   130 ----MYFNAEVNHVDFSENVAVANYINKWVENYTNSLLKDLVSPGDFDAVTHLALINAVYFKGNW 190

  Fly  1845 ATISANLFQTDCSHGSTTDRDGEMFFQVHPTVRQRRLVPIPAVLYRSG-FLAGYEPSLDATVVSF 1908
                .:.|:.:.:...:..:|.|...|:             .::|:.| |..|          .|
  Rat   191 ----KSQFRPENTRTFSFTKDDESEVQI-------------PMMYQQGEFYYG----------EF 228

  Fly  1909 GRVQNTVSTVY---VMPGHQSSISPMDNLDRLERSL--VETAFSDK--QAWRRLLTSLMDRPGME 1966
            ....|....:|   .:|.....||.|..|.|.|..|  :|.....:  :.|    .:.:.:..:|
  Rat   229 SDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLLKPQLIEEW----ANSVKKQKVE 289

  Fly  1967 VQLPRFSHRSFVNASLGLQKMGLRGLFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKIS 2031
            |.||||:....::....|:.:|:..:|..| |:|..:  :..:::|||..:. .:|....||   
  Rat   290 VYLPRFTVEQEIDLKDILKALGVTEIFIKD-ANLTAM--SDKKELFLSKAVH-KSFIEVNEE--- 347

  Fly  2032 EHHHVEMYPAPPLRKRNKDVDATDDDAFDSSERVVDFGSLVQESALGRGFYDDLLDPKYLELPLP 2096
                                         .||..|..| ::..|.:...|               
  Rat   348 -----------------------------GSEAAVASG-MIAISRMAVLF--------------- 367

  Fly  2097 LRPRQARVPDAPRLRFDKPFLYFVRHNPTGMILFMGR 2133
                       |::..|.|||:.:::..||.||||||
  Rat   368 -----------PQVIVDHPFLFLIKNRKTGTILFMGR 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 97/471 (21%)
Serpini1NP_446231.1 neuroserpin 23..410 CDD:239003 99/482 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.