DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43366 and LOC100909605

DIOPT Version :9

Sequence 1:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster
Sequence 2:XP_006240581.2 Gene:LOC100909605 / 100909605 RGDID:6502633 Length:410 Species:Rattus norvegicus


Alignment Length:528 Identity:102/528 - (19%)
Similarity:194/528 - (36%) Gaps:175/528 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1654 PPVKLDPSPESSQGLEASTAMMDEDLQSFARLCN-ELAFSYWRAITSEKISSARSLVISPFALTS 1717
            |..||.......:|.:....:....|.|    || :.|||.::.:..:  :..:::|.|.|::::
  Rat    12 PDGKLGRDTAVQKGQDNKIQVDSSTLSS----CNTDFAFSLYKELVLK--NPDKNIVFSSFSIST 70

  Fly  1718 MLSMVFLGARGSTSGEMNEILKLDDMVTFNP---------HLIFK-NITNSVEQASDSDIATAAF 1772
            .|.::.|||:.:|..|:.|.||.:  :|..|         ||:.: |:.....|.|   ..:|.|
  Rat    71 ALVLLSLGAKNNTLKEILEGLKFN--LTETPEAEIHQGYEHLLQRLNLPGDQVQIS---TGSALF 130

  Fly  1773 VREIFSDRANGKILPFFKEKTQQLYAGHVEEVNFH-------VVNDIVRRRTNLLVKR--HTMGK 1828
            :::      :.:||..|:||.:.||.......:|.       ::||.||::|...:|.  ..:.|
  Rat   131 IKK------HLQILAEFQEKARALYQAEAFSTDFQQPHEAKKLINDYVRKQTQGKIKELISVLDK 189

  Fly  1829 VLEYLRTNSVWVNGPLATISANLFQTDCSHGSTTDRDGEMFFQVHPTVR------QRRLVPIPAV 1887
            ....:..|.::..|                      ..:|.|..|.|.:      :::.|.:|.:
  Rat   190 KTSMVLVNYIYFKG----------------------KWKMPFDPHDTFQSEFYLDEKKSVKVPMM 232

  Fly  1888 --------LYRSGFLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQSSISPMDNLDRLERSLVET 1944
                    .:|       :..|..:|:.. :.....|.::::|       ....:.::|.||   
  Rat   233 KIEKLTTPYFR-------DEELSCSVLEL-KYTGNASALFILP-------DQGRMQQVEASL--- 279

  Fly  1945 AFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSFVNASLGLQKMGLRGLFKSDFADLRGLTGAGNR 2009
               ..:..||...:|..|...|:::|:||..:.:.....|.::|:|.:| |..|||..:|||  :
  Rat   280 ---QPETLRRWKDTLRPRRIDELRMPKFSISTDMRLGDILPELGIREVF-SQQADLSRITGA--K 338

  Fly  2010 DIFLSDMIQINTFSTCGEEKISEHHHVEMYPAPPLRKRNKDVDATDDDAFDSSERVVDFGSLVQE 2074
            |:.:|.::.                                            :.|:|......|
  Rat   339 DLSVSQVVH--------------------------------------------KAVLDVTETGTE 359

  Fly  2075 SALGRG---------FYDDLLDPKYLELPLPLRPRQARVPDAPRLRFDKPFLYFVRHNPTGMILF 2130
            :|...|         ||       |:                 .:.|::|||..:....|.:.||
  Rat   360 AAAATGVKIIPMCAKFY-------YV-----------------TMYFNRPFLMIISDTNTHIALF 400

  Fly  2131 MGRF-NPR 2137
            |.:. ||:
  Rat   401 MAKVTNPK 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 93/492 (19%)
LOC100909605XP_006240581.2 alpha-1-antitrypsin_like 41..404 CDD:239011 93/489 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.