DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or94a

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:386 Identity:72/386 - (18%)
Similarity:161/386 - (41%) Gaps:55/386 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FIGWLPPKQGVLRYVYLTWTLMTFVWCTTYLPLGFLGSYMTQIKSFSPGEFLTSLQVCINAYGSS 94
            |.|::......|.::.:|:|.:..:|..     .|:.|.:.|     .|:.|         |.|.
  Fly    36 FTGFVKRNYRFLLHLPITFTFIGLMWLE-----AFISSNLEQ-----AGQVL---------YMSI 81

  Fly    95 VKVAITYSML---------WRLI-KAKNILDQLDLRCTAMEEREKIHLVVARSNHAFLIFTFVY- 148
            .::|:...:|         |||: :.::..|.      .:..:|::.. ..|....|..|.::| 
  Fly    82 TEMALVVKILSIWHYRTEAWRLMYELQHAPDY------QLHNQEEVDF-WRREQRFFKWFFYIYI 139

  Fly   149 -----CGYAGSTYLSSVLSGRPPWQLYNPFIDWHDGTLKLWVASTLEYMVMSGAVLQDQLSDSYP 208
                 ..|:|.|.:..:.....|:..|.|| :|.: ..:.|.|...:...|:...:.:...|:..
  Fly   140 LISLGVVYSGCTGVLFLEGYELPFAYYVPF-EWQN-ERRYWFAYGYDMAGMTLTCISNITLDTLG 202

  Fly   209 LIYTLILRAHLDMLRERI-RRLRSDENLSEAESYEELVKCV-MDHKLILRYCAIIKPVIQGTIFT 271
            ..:..    |:.:|...: .|||..:|:.....:.:.::.: :.|:.|.......:.::...|.:
  Fly   203 CYFLF----HISLLYRLLGLRLRETKNMKNDTIFGQQLRAIFIMHQRIRSLTLTCQRIVSPYILS 263

  Fly   272 QFLLIGLVL---GFTLINVFFFSDIWTGIASFMFVITILLQTFPFCYTCNLIMEDCESLTHAIFQ 333
            |.:|..|::   |:.|.:|....:....|:...||..::||.:..||..|.|......||:.::.
  Fly   264 QIILSALIICFSGYRLQHVGIRDNPGQFISMLQFVSVMILQIYLPCYYGNEITVYANQLTNEVYH 328

  Fly   334 SNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSVITITKQMNIAD 394
            :||::.....:..|..:::::::|:...||..|.:.:...:.....|:|.:.:.  :|:::
  Fly   329 TNWLECRPPIRKLLNAYMEHLKKPVTIRAGNFFAVGLPIFVKTINNAYSFLALL--LNVSN 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 60/325 (18%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 61/333 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466083
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.