DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or85f

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster


Alignment Length:374 Identity:77/374 - (20%)
Similarity:145/374 - (38%) Gaps:97/374 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 VCINAYGSSVKVAITYSMLWRLIKAKNI-------------------------------LDQLDL 119
            :|:.::|..|.|     |::|:::||.|                               :..|:.
  Fly    45 LCLASHGVCVGV-----MVFRMVEAKTIDNVSLIMRYATLVTYIINSDTKFATVLQRSAIQSLNS 104

  Fly   120 RCTAMEEREKIHLVVARSNHAFLIFTFVYCG--YAGS----------------------TYLSSV 160
            :...:..:..:..:..|.|..:...:|||..  |.||                      ||:...
  Fly   105 KLAELYPKTTLDRIYHRVNDHYWTKSFVYLVIIYIGSSIMVVIGPIITSIIAYFTHNVFTYMHCY 169

  Fly   161 LSGRPPWQLYNPFIDWHDGTLKLWV---ASTLEYMVMSGAVLQDQLSDSYPLIYTLILRAHLDML 222
                 |:.||:|..|      .:|:   ...||::..:..|:.:..:|.:.|.:.:.:..|   .
  Fly   170 -----PYFLYDPEKD------PVWIYISIYALEWLHSTQMVISNIGADIWLLYFQVQINLH---F 220

  Fly   223 RERIRRLRSDENLSEAESYEE--LVKCVMDHKLILRYCAIIKPVIQGTIFTQFLLIGL------- 278
            |..||.| :|...|.....|:  .:..::|.::   :...::..:.| ||.:.||:.|       
  Fly   221 RGIIRSL-ADHKPSVKHDQEDRKFIAKIVDKQV---HLVSLQNDLNG-IFGKSLLLSLLTTAAVI 280

  Fly   279 --VLGFTLINVFFFSDIWTGIASFMFVITILLQTFPFCYTCNLIMEDCESLTHAIFQSNWVDASR 341
              |..:|||.    .....|....:|:.|.::|.:..||....:::....:.||::..::.|||.
  Fly   281 CTVAVYTLIQ----GPTLEGFTYVIFIGTSVMQVYLVCYYGQQVLDLSGEVAHAVYNHDFHDASI 341

  Fly   342 RYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSVITITKQM 390
            .||..||..:...|||:...|.|...||:.:...:...::.|||:..||
  Fly   342 AYKRYLLIIIIRAQQPVELNAMGYLSISLDTFKQLMSVSYRVITMLMQM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 72/363 (20%)
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 63/335 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465955
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.